{"product_id":"proteintech-67469-1-ig","title":"Proteintech, 67469-1-Ig, SF3B3 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe SF3B3 (67469-1-Ig) by Proteintech is a Monoclonal antibody targeting SF3B3 in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, rat samples\n67469-1-Ig targets SF3B3 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HEK-293 cells,  HepG2 cells,  Jurkat cells,  K-562 cells,  HSC-T6 cells,  PC-12 cells,  NIH\/3T3 cells,  RAW 264.7 cells\nPositive IHC detected in: human breast cancer tissue, human gliomas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse heart tissue, rat heart tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:1000-1:4000\nImmunofluorescence (IF)-P: IF-P : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nIntrons are removed from nuclear pre-mRNA in 2-step transesterification reactions. Splicing occured in a large ribonucleoprotein particle, called the spliceosome. Spliceosomal intermediate complexes form on pre-mRNA in the order E, A, B, and C, with the catalytic reactions occurring in complex C. U2 small nuclear ribonucleoproteins are one of the proteins essential for spliceosome assembly and mRNA splicing. Functional U2 snRNP is composed of a 12S unit and 2 splicing factors, SF3A, which is composed of 3 proteins, and SF3B, which conposed of 4 proteins. SF3B3 is one of SF3B, and it's required for 'A' complex assembly formed by the stable binding of U2 snRNP to the brachpoint sequence(BPS) in pre-mRNA.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: mouse\nHost \/ Isotype: Mouse \/ IgG2b\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag6315 Product name: Recombinant human SF3B3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 250-399 aa of BC003146 Sequence: EDPTGNKALWDRGLLNGASQKAEVIMNYHVGETVLSLQKTTLIPGGSESLVYTTLSGGIGILVPFTSHEDHDFFQHVEMHLRSEHPPLCGRDHLSFRSYYFPVKNVIDGDLCEQFNSMEPNKQKNVSEELDRTPPEVSKKLEDIRTRYAF Predict reactive species\nFull Name: splicing factor 3b, subunit 3, 130kDa\nCalculated Molecular Weight: 136 kDa\nObserved Molecular Weight: 130-135 kDa\nGenBank Accession Number: BC003146\nGene Symbol: SF3B3\nGene ID (NCBI): 23450\nRRID: AB_2882698\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q15393\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888075329705,"sku":"67469-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-67469-1-ig","provider":"Iright","version":"1.0","type":"link"}