{"product_id":"proteintech-67487-1-ig","title":"Proteintech, 67487-1-Ig, MFN2 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe MFN2 (67487-1-Ig) by Proteintech is a Monoclonal antibody targeting MFN2 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n67487-1-Ig targets MFN2 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, HeLa cells,  HepG2 cells,  Jurkat cells,  K-562 cells,  HSC-T6 cells,  LNCaP cells\nPositive IHC detected in: human heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:1000-1:4000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:400-1:1600\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMFN2, also named as CPRP1 and KIAA0214, belongs to the mitofusin family. It is an Essential transmembrane GTPase, which mediates mitochondrial fusion. MFN2 acts independently of the cytoskeleton. It therefore plays a central role in mitochondrial metabolism and may be associated with obesity and\/or apoptosis processes. Overexpression of MFN2 induces the formation of mitochondrial networks. It plays an important role in the regulation of vascular smooth muscle cell proliferation. Defects in MFN2 are the cause of Charcot-Marie-Tooth disease type 2A2 (CMT2A2). Defects in MFN2 are the cause of Charcot-Marie-Tooth disease type 6 (CMT6). Ubiquitinated forms of Mfn2 (mono- and polyubiquitinated) are present during mitophagy.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat, fish\nHost \/ Isotype: Mouse \/ IgG2a\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag29873 Product name: Recombinant human MFN2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 2-353 aa of BC017061 Sequence: SLLFSRCNSIVTVKKNKRHMAEVNASPLKHFVTAKKKINGIFEQLGAYIQESATFLEDTYRNAELDPVTTEEQVLDVKGYLSKVRGISEVLARRHMKVAFFGRTSNGKSTVINAMLWDKVLPSGIGHTTNCFLRVEGTDGHEAFLLTEGSEEKRSAKTVNQLAHALHQDKQLHAGSLVSVMWPNSKCPLLKDDLVLMDSPGIDVTTELDSWIDKFCLDADVFVLVANSESTLMQTEKHFFHKVSERLSRPNIFILNNRWDASASEPEYMEEVRRQHMERCTSFLVDELGVVDRSQAGDRIFFVSAKEVLNARIQKAQGMPEGGGALAEGFQVRMFEFQNFERRFEECISQSA Predict reactive species\nFull Name: mitofusin 2\nCalculated Molecular Weight: 757 aa, 86 kDa\nObserved Molecular Weight: 86 kDa\nGenBank Accession Number: BC017061\nGene Symbol: MFN2\nGene ID (NCBI): 9927\nENSEMBL Gene ID: ENSG00000116688\nRRID: AB_2882713\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: O95140\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887984791721,"sku":"67487-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-67487-1-ig","provider":"Iright","version":"1.0","type":"link"}