{"product_id":"proteintech-67492-1-ig","title":"Proteintech, 67492-1-Ig, TRIM5 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe TRIM5 (67492-1-Ig) by Proteintech is a Monoclonal antibody targeting TRIM5 in WB, ELISA applications with reactivity to human samples\n67492-1-Ig targets TRIM5 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, HeLa cells,  HEK-293 cells,  HepG2 cells,  Jurkat cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTRIM5 belongs to the large tripartite motif protein family, members of which typically are composed of 3 zinc-binding domains, a RING, unique B-box type 1 and B-box type 2 domains, followed by a coiled-coil (CC) region. TRIM proteins use homomultimerization to identify specific cell compartments. TRIM5 promotes innate immune signaling and that this activity is amplified by retroviral infection and interaction with the capsid lattice. TRIM5 has 6 variants termed alpha, beta, gamma, delta, epsilon, and iota with the MW of 56 kDa, 46 kDa, 40 kDa, 37 kDa, 31 kDa and 29 kDa. TRIM5 can form homodimers (~70 kDa)  and homotrimers (90-160 kDa).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Mouse \/ IgG2b\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag30059 Product name: Recombinant human TRIM5 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 136-224 aa of BC021258 Sequence: REYQVKLQAALEMLRQKQQEAEELEADIREEKASWKTQIQYDKTNVLADFEQLRDILDWEESNELQNLEKEEEDILKSLTNSETEMVQQ Predict reactive species\nFull Name: tripartite motif-containing 5\nCalculated Molecular Weight: 493 aa, 56 kDa\nObserved Molecular Weight: 56 kDa\nGenBank Accession Number: BC021258\nGene Symbol: TRIM5\nGene ID (NCBI): 85363\nRRID: AB_2882717\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q9C035\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888332886185,"sku":"67492-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-67492-1-ig","provider":"Iright","version":"1.0","type":"link"}