{"product_id":"proteintech-67509-1-ig","title":"Proteintech, 67509-1-Ig, Aconitase 2 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe Aconitase 2 (67509-1-Ig) by Proteintech is a Monoclonal antibody targeting Aconitase 2 in WB, IHC, FC (Intra), ELISA applications with reactivity to human, mouse, rat, pig samples\n67509-1-Ig targets Aconitase 2 in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat, pig samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: PC-12 cells, pig brain tissue,  rat brain tissue,  mouse brain tissue,  HEK-293 cells,  pig cerebellum tissue,  rat cerebellum tissue,  mouse cerebellum tissue,  Neuro-2a cells,  rabbit brain tissue\nPositive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive FC (Intra) detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nACO2(aconitate hydratase, mitochondrial) is also named as citrate hydro-lyase and belongs to the aconitase\/IPM isomerase family. It plays a key function in cellular energy production, and loss of its activity has a major impact on cellular and organismal survival. Western blot shows two bands of 83 kDa and 40 kDa. The 40 kDa fragment decreases with age and oxidative stress, whereas other fragmentation products with molecular weights between 40 and 83 kDa increased with age and MnSOD(mitochondrial manganese superoxide dismutase) deficiency(PMID:12459471). Defects in ACO2 are the cause of infantile cerebellar-retinal degeneration (ICRD).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat, pig\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag17784 Product name: Recombinant human ACO2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-306 aa of BC014092 Sequence: MAPYSLLVTRLQKALGVRQYHVASVLCQRAKVAMSHFEPNEYIHYDLLEKNINIVRKRLNRPLTLSEKIVYGHLDDPASQEIERGKSYLRLRPDRVAMQDATAQMAMLQFISSGLSKVAVPSTIHCDHLIEAQVGGEKDLRRAKDINQEVYNFLATAGAKYGVGFWKPGSGIIHQIILENYAYPGVLLIGTDSHTPNGGGLGGICIGVGGADAVDVMAGIPWELKCPKVIGVKLTGSLSGWSSPKDVILKVAGILTVKGGTGAIVEYHGPGVDSISCTGMATICNMGAEIGATTSVFPYNHRMKKY Predict reactive species\nFull Name: aconitase 2, mitochondrial\nCalculated Molecular Weight: 85 kDa\nObserved Molecular Weight: 85 kDa\nGenBank Accession Number: BC014092\nGene Symbol: ACO2\nGene ID (NCBI): 50\nRRID: AB_2882730\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q99798\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888084177065,"sku":"67509-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-67509-1-ig","provider":"Iright","version":"1.0","type":"link"}