{"product_id":"proteintech-67533-1-ig","title":"Proteintech, 67533-1-Ig, MYL4 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe MYL4 (67533-1-Ig) by Proteintech is a Monoclonal antibody targeting MYL4 in WB, IHC, IF-P, FC (Intra), ELISA applications with reactivity to human, mouse, rat, pig samples\n67533-1-Ig targets MYL4 in WB, IHC, IF-P, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat, pig samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: pig heart tissue, K-562 cells,  Mo7e cells,  TF-1 cells,  rat heart tissues,  mouse heart tissues\nPositive IHC detected in: human heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse heart tissue\nPositive FC (Intra) detected in: C2C12 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:150-1:600\nImmunofluorescence (IF)-P: IF-P : 1:200-1:800\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMyosin light‐chain 4 (MYL4) encodes an essential myosin light chain that is expressed in embryonic whole heart and skeletal muscle. It is specifically expressed in human atria after birth. MYL4 is essential for atrial electrical, functional, and structural integrity, and MYL4 dysfunction can produce severe inherited atrial cardiomyopathy.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat, pig\nCited Reactivity: human, mouse, rat, pig\nHost \/ Isotype: Mouse \/ IgG2b\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag19244 Product name: Recombinant human MYL4 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-197 aa of BC030228 Sequence: MAPKKPEPKKEAAKPAPAPAPAPAPAPAPAPEAPKEPAFDPKSVKIDFTADQIEEFKEAFSLFDRTPTGEMKITYGQCGDVLRALGQNPTNAEVLRVLGKPKPEEMNVKMLDFETFLPILQHISRNKEQGTYEDFVEGLRVFDKESNGTVMGAELRHVLATLGEKMTEAEVEQLLAGQEDANGCINYEAFVKHIMSG Predict reactive species\nFull Name: myosin, light chain 4, alkali; atrial, embryonic\nCalculated Molecular Weight: 197 aa, 22 kDa\nObserved Molecular Weight: 22-25 kDa\nGenBank Accession Number: BC030228\nGene Symbol: MYL4\nGene ID (NCBI): 4635\nRRID: AB_2882752\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P12829\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888012054697,"sku":"67533-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-67533-1-ig","provider":"Iright","version":"1.0","type":"link"}