{"product_id":"proteintech-67593-1-ig","title":"Proteintech, 67593-1-Ig, Mitoferrin 1 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe Mitoferrin 1 (67593-1-Ig) by Proteintech is a Monoclonal antibody targeting Mitoferrin 1 in WB, ELISA applications with reactivity to Human samples\n67593-1-Ig targets Mitoferrin 1 in WB, ELISA applications and shows reactivity with Human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human placenta tissue, HepG2 cells,  human spleen tissue,  K-562 cells,  L02 cells,  LNCaP cells,  TF-1 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMitoferrin (mfrn, SLC25A37), which is highly expressed in fetal and adult hematopoietic tissues, is a member of the vertebrate mitochondrial solute carrier family (SLC25) and is located on the mitochondrial inner membrane. It functions as an essential and high-affinity iron importer for the biosynthesis of mitochondrial heme and iron-sulfur cluster in vertebrate erythroblasts. Additionally, since it was identified as a major depressive disorder (MDD) risk gene, it is likely to be used as a potential biomarker of MDD diagnose.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag26216 Product name: Recombinant human SLC25A37 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-44 aa of BC132799 Sequence: MELRSGSVGSQAVARRMDGDSRDGGGGKDATGSEDYENLPTSAS Predict reactive species\nFull Name: solute carrier family 25, member 37\nObserved Molecular Weight: 40 kDa\nGenBank Accession Number: BC132799\nGene Symbol: Mitoferrin 1\nGene ID (NCBI): 51312\nRRID: AB_2882800\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q9NYZ2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888293400745,"sku":"67593-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-67593-1-ig","provider":"Iright","version":"1.0","type":"link"}