{"product_id":"proteintech-67608-1-ig","title":"Proteintech, 67608-1-Ig, MYBPC3 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe MYBPC3 (67608-1-Ig) by Proteintech is a Monoclonal antibody targeting MYBPC3 in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, rat, pig, rabbit samples\n67608-1-Ig targets MYBPC3 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse heart tissue, H9C2 cells,  rabbit heart tissue,  pig heart tissue\nPositive IHC detected in: human heart tissue, rat heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: rat heart tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)-P: IF-P : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMYBPC3 belongs to the immunoglobulin superfamily and MyBP family. MYBPC3 located in the crossbridge region of vertebrate striated muscle a bands. In vitro it binds MHC, F-actin and native thin filaments, and modifies the activity of actin-activated myosin ATPase. It may modulate muscle contraction or may play a more structural role. Defects in MYBPC3 are the cause of cardiomyopathy familial hypertrophic type 4 (CMH4).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat, pig, rabbit\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag15848 Product name: Recombinant human MYBPC3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-328 aa of BC151211 Sequence: MPEPGKKPVSAFSKKPRSVEVAAGSPAVFEAETERAGVKVRWQRGGSDISASNKYGLATEGTRHTLTVREVGPADQGSYAVIAGSSKVKFDLKVIEAEKAEPMLAPAPAPAEATGAPGEAPAPAAELGESAPSPKGSSSAALNGPTPGAPDDPIGLFVMRPQDGEVTVGGSITFSARVAGASLLKPPVVKWFKGKWVDLSSKVGQHLQLHDSYDRASKVYLFELHITDAQPAFTGSYRCEVSTKDKFDCSNFNLTVHEAMGTGDLDLLSAFRRTSLAGGGRRISDSHEDTGILDFSSLLKKRDSFRTPRDSKLEAPAEEDVWEILRQA Predict reactive species\nFull Name: myosin binding protein C, cardiac\nCalculated Molecular Weight: 1274 aa, 141 kDa\nObserved Molecular Weight: 140-150 kDa\nGenBank Accession Number: BC151211\nGene Symbol: MYBPC3\nGene ID (NCBI): 4607\nRRID: AB_2882814\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q14896\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888301133993,"sku":"67608-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-67608-1-ig","provider":"Iright","version":"1.0","type":"link"}