{"product_id":"proteintech-67610-1-ig","title":"Proteintech, 67610-1-Ig, VPS53 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe VPS53 (67610-1-Ig) by Proteintech is a Monoclonal antibody targeting VPS53 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n67610-1-Ig targets VPS53 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: U2OS cells, HEK-293 cells,  HeLa cells,  NIH\/3T3 cells,  HepG2 cells,  Jurkat cells,  K-562 cells,  HSC-T6 cells,  4T1 cells,  LNCaP cells\nPositive IHC detected in: human liver tissue, rat brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HEK-293 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunohistochemistry (IHC): IHC : 1:300-1:1200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:150-1:600\n\u003cb\u003eBackground Information\u003c\/b\u003e\nVPS53 is a component of the Golgi-associated retrograde protein (GARP) complex, also called VFT (VPS fifty-three) complex, composed of VPS51, VPS52, VPS53 and VPS54. GARP complex functions in traffic from endosomes to the trans-Golgi network (PMID: 15878329). GARP proteins interact with RAB proteins and SNARE proteins.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag29875 Product name: Recombinant human VPS53 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-128 aa of BC029560 Sequence: MVLLDLPSISSQVVRKAPASYTKIVVKGMTRAEMILKVVMAPHEPLVVFVDNYIKLLTDCNTETFQKILDMKGLKRSEQSSMLELLRQRLPAPPSGAESSGSLSLTAPTPEQESSRIRKLEKLIKKRL Predict reactive species\nFull Name: vacuolar protein sorting 53 homolog (S. cerevisiae)\nCalculated Molecular Weight: 832 aa, 94 kDa\nObserved Molecular Weight: 94 kDa\nGenBank Accession Number: BC029560\nGene Symbol: VPS53\nGene ID (NCBI): 55275\nRRID: AB_2882816\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q5VIR6\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888336228521,"sku":"67610-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-67610-1-ig","provider":"Iright","version":"1.0","type":"link"}