{"product_id":"proteintech-67620-1-ig","title":"Proteintech, 67620-1-Ig, WASF3 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe WASF3 (67620-1-Ig) by Proteintech is a Monoclonal antibody targeting WASF3 in IHC, IF-P, ELISA applications with reactivity to Human, Mouse, Rat, Pig, Rabbit samples\n67620-1-Ig targets WASF3 in IHC, IF-P, ELISA applications and shows reactivity with Human, Mouse, Rat, Pig, Rabbit samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse brain tissue, human liver cancer tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\nImmunofluorescence (IF)-P: IF-P : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nWASF3, also named WAVE3 or SCAR3, belongs to the SCAR\/WAVE family. It plays a role in the regulation of cell morphology and cytoskeletal organization. WASF3 is associated with movement, invasion, and metastasis in different cancers such as breast cancer, gastric cancer, and prostate cancer. It has been shown that WASF3 levels are elevated in advanced-stage cancers compared to lower-grade tumors and normal tissue. The 67620-1-Ig antibody recognizes 50-55 kDa and 66-70 kDa proteins similar to the papers.(PMID: 21544801, 15826941, 31038356, 27432794, 31542393)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, Mouse, Rat, Pig, Rabbit\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag29991 Product name: Recombinant human WASF3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 212-391 aa of BC050283 Sequence: GIEFMSDAKKLEQAGSAKEDRVPSGSHASDVTDYSYPATPNHSLHPQPVTPSYAAGDVPPHGPASQAAEHEYRPPSASARHMALNRPQQPPPPPPPQAPEGSQASAPMAPADYGMLPAQIIEYYNPSGPPPPPPPPVIPSAQTAFVSPLQMPMQPPFPASASSTHAAPPHPPSTGLLVTA Predict reactive species\nFull Name: WAS protein family, member 3\nCalculated Molecular Weight: 55 kDa\nObserved Molecular Weight: 50-55 and 66-70 kDa\nGenBank Accession Number: BC050283\nGene Symbol: WASF3\nGene ID (NCBI): 10810\nRRID: AB_2882822\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q9UPY6\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888336490665,"sku":"67620-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-67620-1-ig","provider":"Iright","version":"1.0","type":"link"}