{"product_id":"proteintech-67621-1-ig","title":"Proteintech, 67621-1-Ig, TAF12 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe TAF12 (67621-1-Ig) by Proteintech is a Monoclonal antibody targeting TAF12 in WB, ELISA applications with reactivity to human samples\n67621-1-Ig targets TAF12 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A431 cells, HeLa cells,  HEK-293 cells,  HepG2 cells,  Jurkat cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTAF12, also named TAF15 or TAF2J, is a TBP-associated factor that is contained in Pol I- and Pol II-specific TBP-TAF complexes, it is also a component of the transcription factor IID (TFIID) complex, which is essential for mediating regulation of RNA polymerase transcription. TAF12 plays a key role in regulating eukaryotic gene expression by directly binding promoters and enhancer-bound transactivator proteins. Likewise, TAF12 recruits Gadd45a and the nucleotide excision repair complex to the promoter of rRNA genes leading to active DNA demethylation\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag16597 Product name: Recombinant human TAF12 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-161 aa of BC011986 Sequence: MNQFGPSALINLSNFSSIKPEPASTPPQGSMANSTAVVKIPGTPGAGGRLSPENNQVLTKKKLQDLVREVDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSSTLEVKDVQLHLERQWNMWIPGFGSEEIRPYKKACTTEAHKQRMALIRKTTKK Predict reactive species\nFull Name: TAF12 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 20kDa\nCalculated Molecular Weight: 18 kDa\nObserved Molecular Weight: 21 kDa\nGenBank Accession Number: BC011986\nGene Symbol: TAF12\nGene ID (NCBI): 6883\nRRID: AB_2882823\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q16514\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888329117865,"sku":"67621-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-67621-1-ig","provider":"Iright","version":"1.0","type":"link"}