{"product_id":"proteintech-67626-1-ig","title":"Proteintech, 67626-1-Ig, VSX2 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe VSX2 (67626-1-Ig) by Proteintech is a Monoclonal antibody targeting VSX2 in WB, ELISA applications with reactivity to Human, mouse, rat samples\n67626-1-Ig targets VSX2 in WB, ELISA applications and shows reactivity with Human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Raji cells, rat eye tissue,  Ramos cells,  Daudi cells,  NCCIT cells,  A549 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nVSX2, also named as CHX10 and HOX10, belongs to the paired homeobox family. VSX2 plays a significant role in the specification and morphogenesis of the sensory retina. It may also participate in the development of the cells of the inner nuclear layer, particularly bipolar cells.   Defects in VSX2 are the cause of microphthalmia isolated type 2 (MCOP2). Defects in VSX2 are the cause of microphthalmia with cataracts and iris abnormalities (MCOPCTI). Defects in VSX2 are the cause of microphthalmia isolated with coloboma type 3 (MCOPCB3). The antibody is specific to VSX2.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, mouse, rat\nHost \/ Isotype: Mouse \/ IgG2b\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag29867 Product name: Recombinant human VSX2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-147 aa of BC128153 Sequence: MTGKAGEALSKPKSETVAKSTSGGAPARCTGFGIQEILGLNKEPPSSHPRAALDGLAPGHLLAARSVLSPAGVGGMGLLGPGGLPGFYTQPTFLEVLSDPQSVHLQPLGRASGPLDTSQTASSDSEDVSSSDRKMSKSALNQTKKRK Predict reactive species\nFull Name: visual system homeobox 2\nCalculated Molecular Weight: 361 aa, 39 kDa\nObserved Molecular Weight: 45 kDa\nGenBank Accession Number: BC128153\nGene Symbol: VSX2\nGene ID (NCBI): 338917\nRRID: AB_2882827\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P58304\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888336425129,"sku":"67626-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-67626-1-ig","provider":"Iright","version":"1.0","type":"link"}