{"product_id":"proteintech-67647-1-ig","title":"Proteintech, 67647-1-Ig, PPM1B Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe PPM1B (67647-1-Ig) by Proteintech is a Monoclonal antibody targeting PPM1B in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n67647-1-Ig targets PPM1B in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HEK-293 cells,  HepG2 cells,  Jurkat cells,  K-562 cells,  HSC-T6 cells,  NIH\/3T3 cells\nPositive IHC detected in: human breast cancer tissue, mouse skeletal muscle tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: A431 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPPM1B can identify 4 isoforms with the WM of 36-55 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: monkey\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag3871 Product name: Recombinant human PPM1B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-192 aa of BC012002 Sequence: MSIVLVCFSNAPKVSDEAVKKDSELDKHLESRVEEIMEKSGEEGMPDLAHVMRILSAENIPNLPPGGGLAGKRNVIEAVYSRLNPHRESDGASDEAEESGSQGKLVEALRQMRINHRGNYRQLLEEMLTSYRLAKVEGEESPAEPAATATSSNSDAGNPVTMQESHTESESGLAELDSSNEDAGTKMSGEKI Predict reactive species\nFull Name: protein phosphatase 1B (formerly 2C), magnesium-dependent, beta isoform\nCalculated Molecular Weight: 479 aa, 53 kDa\nObserved Molecular Weight: 36, 53 kDa\nGenBank Accession Number: BC012002\nGene Symbol: PPM1B\nGene ID (NCBI): 5495\nRRID: AB_2882847\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: O75688\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888047968425,"sku":"67647-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-67647-1-ig","provider":"Iright","version":"1.0","type":"link"}