{"product_id":"proteintech-67686-1-ig","title":"Proteintech, 67686-1-Ig, cyclin B1 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe cyclin B1 (67686-1-Ig) by Proteintech is a Monoclonal antibody targeting cyclin B1 in WB, IHC, IF\/ICC, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples\n67686-1-Ig targets cyclin B1 in WB, IHC, IF\/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, HeLa cells,  NIH\/3T3 cells,  HSC-T6 cells,  K-562 cells,  Jurkat cells,  HEK-293 cells\nPositive IHC detected in: human tonsillitis tissue, rat skin tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells, HT-29 cells\nPositive FC (Intra) detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunohistochemistry (IHC): IHC : 1:1000-1:4000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:400-1:1600\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCyclin B1 is a regulatory protein involved in mitosis. The gene product complexes with p34(cdc2) to form the maturation-promoting factor (MPF). Two alternative transcripts have been found, a constitutively expressed transcript and a cell cycle-regulated transcript, that is expressed predominantly during G2\/M phase of the cell cycle. The different transcripts result from the use of alternate transcription initiation sites. The antibody is specific to CCNB1. We got a 55-60 kDa band in western blotting maybe due to  phosphorylation.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag29444 Product name: Recombinant human CCNB1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-140 aa of BC006510 Sequence: MALRVTRNSKINAENKAKINMAGAKRVPTAPAATSKPGLRPRTALGDIGNKVSEQLQAKMPMKKEAKPSATGKVIDKKLPKPLEKVPMLVPVPVSEPVPEPEPEPEPEPVKEEKLSPEPILVDTASPSPMETSGCAPAEE Predict reactive species\nFull Name: cyclin B1\nCalculated Molecular Weight: 48 kDa\nObserved Molecular Weight: 55 kDa\nGenBank Accession Number: BC006510\nGene Symbol: Cyclin B1\nGene ID (NCBI): 891\nRRID: AB_2882879\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: P14635\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887983055017,"sku":"67686-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-67686-1-ig","provider":"Iright","version":"1.0","type":"link"}