{"product_id":"proteintech-67687-1-ig","title":"Proteintech, 67687-1-Ig, ANP32A Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe ANP32A (67687-1-Ig) by Proteintech is a Monoclonal antibody targeting ANP32A in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n67687-1-Ig targets ANP32A in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, HSC-T6 cells,  HuH-7 cells,  HeLa cells,  Raji cells,  Jurkat cells,  Sp2\/0 cells\nPositive IHC detected in: mouse brain tissue, human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: A431 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunohistochemistry (IHC): IHC : 1:200-1:800\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nANP32A, an acidic leucine-rich nuclear phosphoprotein, is a member of the inhibitor of the histone acetyltransferase (INHAT) complex and preferentially binds to unmodified histone H3 tails in vitro. ANP32A is expressed in normal tissues as well as in pancreatic, breast and prostate cancer and other malignant tumors. ANP32A plays an important role in cell proliferation, apoptosis, transcriptional regulation, signal transduction and other processes.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Mouse \/ IgG2a\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag8546 Product name: Recombinant human ANP32A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-249 aa of BC007200 Sequence: MEMGRRIHLELRNRTPSDVKELVLDNSRSNEGKLEGLTDEFEELEFLSTINVGLTSIANLPKLNKLKKLELSDNRVSGGLEVLAEKCPNLTHLNLSGNKIKDLSTIEPLKKLENLKSLDLFNCEVTNLNDYRENVFKLLPQLTYLDGYDRDDKEAPDSDAEGYVEGLDDEEEDEDEEEYDEDAQVVEDEEDEDEEEEGEEEDVSGEEEEDEEGYNDGEVDDEEDEEELGEEERGQKRKREPEDEGEDDD Predict reactive species\nFull Name: acidic (leucine-rich) nuclear phosphoprotein 32 family, member A\nCalculated Molecular Weight: 249 aa, 29 kDa\nObserved Molecular Weight: 29 kDa\nGenBank Accession Number: BC007200\nGene Symbol: ANP32A\nGene ID (NCBI): 8125\nRRID: AB_2882880\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P39687\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888036008105,"sku":"67687-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-67687-1-ig","provider":"Iright","version":"1.0","type":"link"}