{"product_id":"proteintech-67734-1-ig","title":"Proteintech, 67734-1-Ig, CTPS2 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe CTPS2 (67734-1-Ig) by Proteintech is a Monoclonal antibody targeting CTPS2 in WB, IHC, IF\/ICC, IF-P, ELISA applications with reactivity to human, mouse, rat samples\n67734-1-Ig targets CTPS2 in WB, IHC, IF\/ICC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: LNCaP cells, U2OS cells,  HeLa cells,  HEK-293 cells,  HepG2 cells,  K-562 cells,  PC-12 cells,  NIH\/3T3 cells,  RAW 264.7 cells\nPositive IHC detected in: human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: human prostate cancer tissue\nPositive IF\/ICC detected in: PC-12 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\nImmunofluorescence (IF)-P: IF-P : 1:200-1:800\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:400-1:1600\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCTPS2 (CTP synthase 2) is also named as UTP--ammonia ligase 2 and belongs to the CTP synthase family.It catalyzes the ATP-dependent amination of UTP to CTP with either L-glutamine or ammonia as the source of nitrogen and constitutes the rate-limiting enzyme in the synthesis of cytosine nucleotides. This antibody specifically detects only CTPS2 and not also CTPS1.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Mouse \/ IgG2a\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag30258 Product name: Recombinant human CTPS2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 30-373 aa of BC034986 Sequence: CGLRVTAIKIDPYINIDAGTFSPYEHGEVFVLNDGGEVDLDLGNYERFLDINLYKDNNITTGKIYQHVINKERRGDYLGKTVQVVPHITDAVQEWVMNQAKVPVDGNKEEPQICVIELGGTIGDIEGMPFVEAFRQFQFKAKRENFCNIHVSLVPQLSATGEQKTKPTQNSVRALRGLGLSPDLIVCRSSTPIEMAVKEKISMFCHVNPEQVICIHDVSSTYRVPVLLEEQSIVKYFKERLHLPIGDSASNLLFKWRNMADRYERLQKICSIALVGKYTKLRDCYASVFKALEHSALAINHKLNLMYIDSIDLEKITETEDPVKFHEAWQKLCKADGILVPGGF Predict reactive species\nFull Name: CTP synthase II\nCalculated Molecular Weight: 586 aa, 66 kDa\nObserved Molecular Weight: 66 kDa\nGenBank Accession Number: BC034986\nGene Symbol: CTPS2\nGene ID (NCBI): 56474\nRRID: AB_2882918\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q9NRF8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888112586921,"sku":"67734-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-67734-1-ig","provider":"Iright","version":"1.0","type":"link"}