{"product_id":"proteintech-67746-1-ig","title":"Proteintech, 67746-1-Ig, USP14 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe USP14 (67746-1-Ig) by Proteintech is a Monoclonal antibody targeting USP14 in WB, IF\/ICC, ELISA applications with reactivity to Human, Mouse, Rat, Pig, Rabbit samples\n67746-1-Ig targets USP14 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with Human, Mouse, Rat, Pig, Rabbit samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HCT 116 cells, HeLa cells,  Jurkat cells,  HSC-T6 cells,  NIH\/3T3 cells,  pig brain tissue,  rabbit brain tissue,  rat brain tissue,  mouse brain tissue,  U2OS cells,  K-562 cells\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nUSP14(Ubiquitin carboxyl-terminal hydrolase 14) is also named as TGT and belongs to the peptidase C19 family. Mammalian USP14 is unique among known UBP enzymes in that it is activated catalytically upon specific association with the 26S proteasome. USP14 inhibition accelerated the degradation of oxidized proteins and enhanced resistance to oxidative stress.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, Mouse, Rat, Pig, Rabbit\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag6312 Product name: Recombinant human USP14 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-294 aa of BC003556 Sequence: MPLYSVTVKWGKEKFEGVELNTDEPPMVFKAQLFALTGVQPARQKVMVKGGTLKDDDWGNIKIKNGMTLLMMGSADALPEEPSAKTVFVEDMTEEQLASAMELPCGLTNLGNTCYMNATVQCIRSVPELKDALKRYAGALRASGEMASAQYITAALRDLFDSMDKTSSSIPPIILLQFLHMAFPQFAEKGEQGQYLQQDANECWIQMMRVLQQKLEAIEDDSVKETDSSSASAATPSKKKSLIDQFFGVEFETTMKCTESEEEEVTKGKENQLQLSCFINQEVKYLFTGLKLRL Predict reactive species\nFull Name: ubiquitin specific peptidase 14 (tRNA-guanine transglycosylase)\nCalculated Molecular Weight: 54 kDa\nObserved Molecular Weight: 60 kDa\nGenBank Accession Number: BC003556\nGene Symbol: USP14\nGene ID (NCBI): 9097\nRRID: AB_2918515\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: P54578\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888013299881,"sku":"67746-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-67746-1-ig","provider":"Iright","version":"1.0","type":"link"}