{"product_id":"proteintech-67763-1-ig","title":"Proteintech, 67763-1-Ig, GPX4 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe GPX4 (67763-1-Ig) by Proteintech is a Monoclonal antibody targeting GPX4 in WB, IHC, IF\/ICC, IF-P, ELISA applications with reactivity to human, mouse, rat, pig, rabbit, canine, chicken, zebrafish, hamster samples\n67763-1-Ig targets GPX4 in WB, IHC, IF\/ICC, IF-P, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit, canine, chicken, zebrafish, hamster samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: EC109 cells, HEK-293 cells,  NCCIT cells,  pig brain tissue,  rabbit testis tissue,  Hela cells,  HepG2 cells,  Jurkat cells,  HSC-T6 cells,  4T1 cells,  ATDC-5 cells,  MDCK cells,  CHO cells,  Chicken brain tissue,  Zebrafish tissue,  human platelet tissue,  rat brain tissue,  mouse brain tissue,  rabbit brain tissue,  rat testis tisssue,  mouse testis tissue\nPositive IHC detected in: human liver cancer tissue, mouse testis tissue,  rat testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse testis tissue\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:1000-1:4000\nImmunofluorescence (IF)-P: IF-P : 1:200-1:800\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:400-1:1600\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGPX4 (Phospholipid hydroperoxide glutathione peroxidase, mitochondrial) protects cells against membrane lipid peroxidation and cell death. Required for normal sperm development and male fertility.It has two isforms about 20KDa and 22KDa, respectively. GPX4 is a monomer,but it has a tendency to form higher mass oligomers (PMID:17630701). It presents primarily in testis.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat, pig, rabbit, canine, chicken, zebrafish, hamster\nCited Reactivity: human, mouse, rat, pig, rabbit, chicken, bovine, sheep, goat, duck\nHost \/ Isotype: Mouse \/ IgG2b\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag30650 Product name: Recombinant human GPX4 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 107-197 aa of BC021567 Sequence: KQEPGSNEEIKEFAAGYNVKFDMFSKICVNGDDAHPLWKWMKIQPKGKGILGNAIKWNFTKFLIDKNGCVVKRYGPMEEPLVIEKDLPHYF Predict reactive species\nFull Name: glutathione peroxidase 4 (phospholipid hydroperoxidase)\nObserved Molecular Weight: 20-23 kDa\nGenBank Accession Number: BC021567\nGene Symbol: GPX4\nGene ID (NCBI): 2879\nRRID: AB_2909469\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P36969\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887967391913,"sku":"67763-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-67763-1-ig","provider":"Iright","version":"1.0","type":"link"}