{"product_id":"proteintech-67770-1-ig","title":"Proteintech, 67770-1-Ig, PSMD2 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe PSMD2 (67770-1-Ig) by Proteintech is a Monoclonal antibody targeting PSMD2 in WB, ELISA applications with reactivity to human, mouse, rat samples\n67770-1-Ig targets PSMD2 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, HeLa cells,  HepG2 cells,  HEK-293 cells,  Jurkat cells,  K-562 cells,  HSC-T6 cells,  NIH\/3T3 cells,  4T1 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:20000-1:100000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTumor necrosis factor type 1 receptor-associated protein 2 (TRAP2), encoded by PSMD2 gene, is a non-ATPase regulatory subunit of the 26 proteasome which is involved in the ATP-dependent degradation of ubiquitinated proteins. The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. TRAP2 may also participate in the TNF signalling pathway since it interacts with the tumor necrosis factor type 1 receptor.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Mouse \/ IgG2a\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag6543 Product name: Recombinant human PSMD2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 561-908 aa of BC002368 Sequence: GLGLNHLGKGEAIEAILAALEVVSEPFRSFANTLVDVCAYAGSGNVLKVQQLLHICSEHFDSKEKEEDKDKKEKKDKDKKEAPADMGAHQGVAVLGIALIAMGEEIGAEMALRTFGHLLRYGEPTLRRAVPLALALISVSNPRLNILDTLSKFSHDADPEVSYNSIFAMGMVGSGTNNARLAAMLRQLAQYHAKDPNNLFMVRLAQGLTHLGKGTLTLCPYHSDRQLMSQVAVAGLLTVLVSFLDVRNIILGKSHYVLYGLVAAMQPRMLVTFDEELRPLPVSVRVGQAVDVVGQAGKPKTITGFQTHTTPVLLAHGERAELATEEFLPVTPILEGFVILRKNPNYDL Predict reactive species\nFull Name: proteasome (prosome, macropain) 26S subunit, non-ATPase, 2\nCalculated Molecular Weight: 100 kDa\nObserved Molecular Weight: 100 kDa\nGenBank Accession Number: BC002368\nGene Symbol: PSMD2\nGene ID (NCBI): 5708\nRRID: AB_2918536\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q13200\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887974273193,"sku":"67770-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-67770-1-ig","provider":"Iright","version":"1.0","type":"link"}