{"product_id":"proteintech-67789-1-ig","title":"Proteintech, 67789-1-Ig, CD73 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe CD73 (67789-1-Ig) by Proteintech is a Monoclonal antibody targeting CD73 in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, rat samples\n67789-1-Ig targets CD73 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HepG2 cells,  A549 cells,  HT-29 cells,  U-87 MG cells\nPositive IHC detected in: human tonsillitis tissue, mouse kidney tissue,  rat kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: human appendicitis tissue, human tonsillitis tissue,  rat liver tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\nImmunofluorescence (IF)-P: IF-P : 1:250-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCD73, also known as ecto-5'-nucleotidase (5'-NT), is a 70-kDa, glycosyl-phosphatidylinositol-linked membrane-bound glycoprotein found in most tissues (PMID: 18404475; 20179192). CD73 is an ectoenzyme that catalyzes the dephosphorylation of AMP and other nucleoside monophosphates (PMID: 9553767). In the human immune system, CD73 is expressed on subsets of T and B cells, on germinal center follicular dendritic cells, and on thymic medullary reticular fibroblasts and epithelial cells (PMID: 2137649; 9553767). CD73 is highly expressed in many human solid tumors and is closely involved in cancer progression (PMID: 20179192).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag30616 Product name: Recombinant human NT5E,CD73 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 32-264 aa of BC015940 Sequence: LHTNDVHSRLEQTSEDSSKCVNASRCMGGVARLFTKVQQIRRAEPNVLLLDAGDQYQGTIWFTVYKGAEVAHFMNALRYDAMALGNHEFDNGVEGLIEPLLKEAKFPILSANIKAKGPLASQISGLYLPYKVLPVGDEVVGIVGYTSKETPFLSNPGTNLVFEDEITALQPEVDKLKTLNVNKIIALGHSGFEMDKLIAQKVRGVDVVVGGHSNTFLYTGNCFKRIAWARMSR Predict reactive species\nFull Name: 5'-nucleotidase, ecto (CD73)\nCalculated Molecular Weight: 29 kDa, 63 kDa\nObserved Molecular Weight: 60-70 kDa\nGenBank Accession Number: BC015940\nGene Symbol: CD73\nGene ID (NCBI): 4907\nRRID: AB_2918553\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: P21589\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888107081897,"sku":"67789-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-67789-1-ig","provider":"Iright","version":"1.0","type":"link"}