{"product_id":"proteintech-67793-1-ig","title":"Proteintech, 67793-1-Ig, Desmin Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe Desmin (67793-1-Ig) by Proteintech is a Monoclonal antibody targeting Desmin in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, pig samples\n67793-1-Ig targets Desmin in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, pig samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: pig heart tissue, mouse skeletal muscle tissue,  mouse testis tissue,  pig skeletal muscle,  pig colon\nPositive IHC detected in: human colon tissue, human placenta tissue,  human rectal cancer tissue,  mouse skeletal muscle tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: human colon tissue, human appendicitis tissue,  mouse skeletal muscle tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:1000-1:4000\nImmunofluorescence (IF)-P: IF-P : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nDesmin is the main intermediate filament protein in skeletal and cardiac muscle cells and is essential for both the structural integrity and the survival of muscle cells. As an abundant muscle-specific protein, desmin has been widely used as a marker of muscle derived tumors. Anti-desmin is also valuable in the differential diagnosis of tumors of uncertain origin.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, pig\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag9675 Product name: Recombinant human Desmin protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 121-470 aa of BC032116 Sequence: NYIEKVRFLEQQNAALAAEVNRLKGREPTRVAELYEEELRELRRQVEVLTNQRARVDVERDNLLDDLQRLKAKLQEEIQLKEEAENNLAAFRADVDAATLARIDLERRIESLNEEIAFLKKVHEEEIRELQAQLQEQQVQVEMDMSKPDLTAALRDIRAQYETIAAKNISEAEEWYKSKVSDLTQAANKNNDALRQAKQEMMEYRHQIQSYTCEIDALKGTNDSLMRQMRELEDRFASEASGYQDNIARLEEEIRHLKDEMARHLREYQDLLNVKMALDVEIATYRKLLEGEESRINLPIQTYSALNFRETSPEQRGSEVHTKKTVMIKTIETRDGEVVSEATQQQHEVL Predict reactive species\nFull Name: desmin\nCalculated Molecular Weight: 470 aa, 54 kDa\nObserved Molecular Weight: 52 kDa\nGenBank Accession Number: BC032116\nGene Symbol: Desmin\nGene ID (NCBI): 1674\nRRID: AB_2918557\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: P17661\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887995998377,"sku":"67793-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-67793-1-ig","provider":"Iright","version":"1.0","type":"link"}