{"product_id":"proteintech-67834-1-ig","title":"Proteintech, 67834-1-Ig, LMCD1 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe LMCD1 (67834-1-Ig) by Proteintech is a Monoclonal antibody targeting LMCD1 in WB, IHC, IF\/ICC, ELISA applications with reactivity to Human, mouse, rat samples\n67834-1-Ig targets LMCD1 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with Human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: U2OS cells, human placenta tissue\nPositive IHC detected in: human colon tissue, mouse skeletal muscle tissue,  rat skeletal muscle tissue,  human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: MCF-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nLIM and cysteine-rich domains-1 (LMCD1) is a member of the LIM protein family, which contains an N-terminal cysteine-rich region, two C-terminal LIM domains and a central PET (Prickle, Espinas, and Testin) domain. LMCD1 has been reported in cardiac tissues and lung acting as a transcriptional repressor for GATA6. The mutations of LMCD1 promote cell migration and tumor metastasis in hepatocellular carcinoma. (PMID: 31501411) It has calculated molecular weight around 41kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag28331 Product name: Recombinant human LMCD1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-365 aa of BC000646 Sequence: MAKVAKDLNPGVKKMSLGQLQSARGVACLGCKGTCSGFEPHSWRKICKSCKCSQEDHCLTSDLEDDRKIGRLLMDSKYSTLTARVKGGDGIRIYKRNRMIMTNPIATGKDPTFDTITYEWAPPGVTQKLGLQYMELIPKEKQPVTGTEGAFYRRRQLMHQLPIYDQDPSRCRGLLENELKLMEEFVKQYKSEALGVGEVALPGQGGLPKEEGKQQEKPEGAETTAATTNGSLSDPSKEVEYVCELCKGAAPPDSPVVYSDRAGYNKQWHPTCFVCAKCSEPLVDLIYFWKDGAPWCGRHYCESLRPRCSGCDEIIFAEDYQRVEDLAWHRKHFVCEGCEQLLSGRAYIVTKGQLLCPTCSKSKRS Predict reactive species\nFull Name: LIM and cysteine-rich domains 1\nCalculated Molecular Weight: 41 kDa\nObserved Molecular Weight: ~40 kDa\nGenBank Accession Number: BC000646\nGene Symbol: LMCD1\nGene ID (NCBI): 29995\nRRID: AB_2918596\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q9NZU5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888067006633,"sku":"67834-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-67834-1-ig","provider":"Iright","version":"1.0","type":"link"}