{"product_id":"proteintech-67845-1-ig","title":"Proteintech, 67845-1-Ig, VAPA Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe VAPA (67845-1-Ig) by Proteintech is a Monoclonal antibody targeting VAPA in WB, IHC, ELISA applications with reactivity to Human, Mouse, Rat samples\n67845-1-Ig targets VAPA in WB, IHC, ELISA applications and shows reactivity with Human, Mouse, Rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HEK-293 cells,  HepG2 cells,  Jurkat cells,  K-562 cells,  HSC-T6 cells,  PC-12 cells,  NIH\/3T3 cells,  Neuro-2a cells\nPositive IHC detected in: human liver cancer tissue, human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nVAPA (Vesicle-associated membrane protein-associated protein A), also known as VAP33, is a 33-kDa, ubiquitously expressed integral membrane protein of the VAMP-associated protein (VAP) family. It is present in the plasma membrane and in intracellular vesicles, playing a role in vesicle trafficking.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, Mouse, Rat\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag7819 Product name: Recombinant human VAPA protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-221 aa of BC002992 Sequence: MASASGAMAKHEQILVLDPPTDLKFKGPFTDVVTTNLKLRNPSDRKVCFKVKTTAPRRYCVRPNSGIIDPGSTVTVSVMLQPFDYDPNEKSKHKFMVQTIFAPPNTSDMEAVWKEAKPDELMDSKLRCVFEMPNENDKLNDMEPSKAVPLNASKQDGPMPKPHSVSLNDTETRKLMEECKRLQGEMMKLSEENRHLRDEGLRLRKVAHSDKPGSTSTASFR Predict reactive species\nFull Name: VAMP (vesicle-associated membrane protein)-associated protein A, 33kDa\nCalculated Molecular Weight: 28 kDa\nObserved Molecular Weight: 33 kDa\nGenBank Accession Number: BC002992\nGene Symbol: VAPA\nGene ID (NCBI): 9218\nRRID: AB_2918607\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q9P0L0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888335704233,"sku":"67845-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-67845-1-ig","provider":"Iright","version":"1.0","type":"link"}