{"product_id":"proteintech-67847-1-ig","title":"Proteintech, 67847-1-Ig, PSMB1 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe PSMB1 (67847-1-Ig) by Proteintech is a Monoclonal antibody targeting PSMB1 in WB, IHC, IF\/ICC, FC (Intra), ELISA applications with reactivity to human samples\n67847-1-Ig targets PSMB1 in WB, IHC, IF\/ICC, FC (Intra), ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells, K-562 cells,  THP-1 cells,  U-937 cells\nPositive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: U2OS cells\nPositive FC (Intra) detected in: Jurkat cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:400-1:1600\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPSMB1(Proteasome subunit beta type-1) is also named as PSC5 and belongs to the peptidase T1B family. The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The gene encodes a 241 amino acid protein with a 28 amino acid propeptide and two glycosylation sites.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag30791 Product name: Recombinant human PSMB1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-241 aa of BC020807 Sequence: MLSSTAMYSAPGRDLGMEPHRAAGPLQLRFSPYVFNGGTILAIAGEDFAIVASDTRLSEGFSIHTRDSPKCYKLTDKTVIGCSGFHGDCLTLTKIIEARLKMYKHSNNKAMTTGAIAAMLSTILYSRRFFPYYVYNIIGGLDEEGKGAVYSFDPVGSYQRDSFKAGGSASAMLQPLLDNQVGFKNMQNVEHVPLSLDRAMRLVKDVFISAAERDVYTGDALRICIVTKEGIREETVSLRKD Predict reactive species\nFull Name: proteasome (prosome, macropain) subunit, beta type, 1\nCalculated Molecular Weight: 241 aa, 26 kDa\nObserved Molecular Weight: 25 kDa\nGenBank Accession Number: BC020807\nGene Symbol: PSMB1\nGene ID (NCBI): 5689\nRRID: AB_2918609\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: P20618\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888314798249,"sku":"67847-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-67847-1-ig","provider":"Iright","version":"1.0","type":"link"}