{"product_id":"proteintech-67864-1-ig","title":"Proteintech, 67864-1-Ig, Synaptophysin Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe Synaptophysin (67864-1-Ig) by Proteintech is a Monoclonal antibody targeting Synaptophysin in WB, IHC, IF\/ICC, IF-P, IF-Fro, ELISA applications with reactivity to human, mouse, rat, pig, rabbit samples\n67864-1-Ig targets Synaptophysin in WB, IHC, IF\/ICC, IF-P, IF-Fro, ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: PC-12 cells, pig brain tissue,  rabbit brain tissue,  rat brain tissue,  mouse brain tissue,  pig cerebellum tissue,  rabbit cerebellum tissue,  rat cerebellum tissue,  mouse cerebellum tissue\nPositive IHC detected in: mouse brain tissue, human rectal cancer tissue,  rat pancreas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse pancreas tissue, mouse brain tissue\nPositive IF-Fro detected in: rat brain tissue\nPositive IF\/ICC detected in: SH-SY5Y cells, PC-12 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:20000-1:100000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\nImmunofluorescence (IF)-P: IF-P : 1:200-1:800\nImmunofluorescence (IF)-FRO: IF-FRO : 1:200-1:800\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:250-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSynaptophysin (SYP, also known as major synaptic vesicle protein p38) is a 38-kDa integral membrane glycoprotein that regulates synaptic vesicle endocytosis. It is the most abundant synaptic vesicle protein by mass. Synaptophysin is present in neuroendocrine cells and neurons that participate in synaptic transmission. Synaptophysin is a useful marker for identification of neuroendocrine cells and neoplasms. (PMID: 3010302; 21658579)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat, pig, rabbit\nCited Reactivity: human, mouse, rat, pig\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag11803 Product name: Recombinant human Synaptophysin; SYP protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 50-313 aa of BC064550 Sequence: ELQLSVDCANKTESDLSIEVEFEYPFRLHQVYFDAPTCRGGTTKVFLVGDYSSSAEFFVTVAVFAFLYSMGALATYIFLQNKYRENNKGPMLDFLATAVFAFMWLVSSSAWAKGLSDVKMATDPENIIKEMPVCRQTGNTCKELRDLVTSGLNTSVVFGFLNLVLWVGNLWFVFKETGWAAPFLRAPPGAPEKQPAPGDAYGDAGYGQGPGGYGPQDSYGPQGGYQPDYGQPAGSGGSGYGPQGDYGQQGYGPQGAPTSFSNQM Predict reactive species\nFull Name: synaptophysin\nCalculated Molecular Weight: 313 aa, 34 kDa\nObserved Molecular Weight: 38 kDa\nGenBank Accession Number: BC064550\nGene Symbol: Synaptophysin\nGene ID (NCBI): 6855\nRRID: AB_2918622\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: P08247\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887983874217,"sku":"67864-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-67864-1-ig","provider":"Iright","version":"1.0","type":"link"}