{"product_id":"proteintech-67884-1-ig","title":"Proteintech, 67884-1-Ig, ADC Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe ADC (67884-1-Ig) by Proteintech is a Monoclonal antibody targeting ADC in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat, pig samples\n67884-1-Ig targets ADC in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat, pig samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293T cells, HeLa cells,  mouse brain tissue,  mouse cerebellum tissue,  rat cerebellum tissue,  HEK-293 cells,  pig brain tissue\nPositive IHC detected in: rat liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: A431 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nAntizyme inhibitor 2 (AZIN2) is a member of the antizyme inhibitor family, witch is able to bind to AZs and inhibit their action on both ODC activity and polyamine uptake. AZIN2 is predominantly expressed in the brain and testis and localized in the endoplasmic reticulum-golgi intermediate compartment. Available data suggest its role in cell growth, spermiogenesis, vesicular trafficking and secretion. Accumulation of azin2 has also been observed in brains of patients with Alzheimer's disease (PMID: 19832840) . AZIN2 has 5 described insoforms produced by alternative splicing. The molecular weight of AZIN2 is about 50 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat, pig\nCited Reactivity: human\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag31049 Product name: Recombinant human ADC protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 251-460 aa of BC028128 Sequence: EIASVINSALDLYFPEGCGVDIFAELGRYYVTSAFTVAVSIIAKKEVLLDQPGREEENGSTSKTIVYHLDEGVYGIFNSVLFDNICPTPILQKKPSTEQPLYSSSLWGPAVDGCDCVAEGLWLPQLHVGDWLVFDNMGAYTVGMGSPFWGTQACHITYAMSRVAWEALRRQLMAAEQEDDVEGVCKPLSCGWEITDTLCVGPVFTPASIM Predict reactive species\nFull Name: arginine decarboxylase\nCalculated Molecular Weight: 460 aa, 50 kDa\nObserved Molecular Weight: 48-50 kDa\nGenBank Accession Number: BC028128\nGene Symbol: ADC\nGene ID (NCBI): 113451\nRRID: AB_2918641\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q96A70\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888052293801,"sku":"67884-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-67884-1-ig","provider":"Iright","version":"1.0","type":"link"}