{"product_id":"proteintech-67886-1-ig","title":"Proteintech, 67886-1-Ig, KDM1B Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe KDM1B (67886-1-Ig) by Proteintech is a Monoclonal antibody targeting KDM1B in WB, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples\n67886-1-Ig targets KDM1B in WB, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HCT 116 cells, K-562 cells,  C6 cells,  NIH\/3T3 cells,  A549 cells,  HeLa cells,  Jurkat cells\nPositive FC (Intra) detected in: SW 1990 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Mouse \/ IgG2b\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag30672 Product name: Recombinant human KDM1B protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 666-822 aa of NM_001364614 Sequence: FPYRFWDSKVQGADFFGHVPPSASKRGLFAVFYDMDPQKKHSVLMSVIAGEAVASVRTLDDKQVLQQCMATLRELFKEQEVPDPTKYFVTRWSTDPWIQMAYSFVKTGGSGEAYDIIAEDIQGTVFFAGEATNRHFPQTVTGAYLSGVREASKIAAF Predict reactive species\nFull Name: amine oxidase (flavin containing) domain 1\nCalculated Molecular Weight: 92 kDa\nObserved Molecular Weight: 92 kDa\nGenBank Accession Number: NM_001364614\nGene Symbol: KDM1B\nGene ID (NCBI): 221656\nRRID: AB_2918643\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q8NB78\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888288387241,"sku":"67886-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-67886-1-ig","provider":"Iright","version":"1.0","type":"link"}