{"product_id":"proteintech-67891-1-ig","title":"Proteintech, 67891-1-Ig, ARL8B Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe ARL8B (67891-1-Ig) by Proteintech is a Monoclonal antibody targeting ARL8B in WB, IF\/ICC, ELISA applications with reactivity to Human, mouse, rat, pig samples\n67891-1-Ig targets ARL8B in WB, IF\/ICC, ELISA applications and shows reactivity with Human, mouse, rat, pig samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: K-562 cells, Jurkat cells,  HSC-T6 cells,  NIH\/3T3 cells,  LNCaP cells,  pig brain tissue,  rat brain tissue\nPositive IF\/ICC detected in: A549 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nARL8B ( ADP-ribosylation factor-like 8B) , also known as ARL10C or GIE1, is a small GTPase of the Arl-family, that is associated with the lysosome. ARL8A interacts with Tubulin, and plays a role in lysosome motility, as well as in chromosomal segregation. ARL8B plays a role in the spatial distribution and positioning of lysosomes. ARL8B is regarded as a regulator of endosome to lysosome trafficking pathways of special significance for host defense.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, mouse, rat, pig\nHost \/ Isotype: Mouse \/ IgG2a\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag3711 Product name: Recombinant human ARL8B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-186 aa of BC013131 Sequence: MLALISRLLDWFRSLFWKEEMELTLVGLQYSGKTTFVNVIASGQFSEDMIPTVGFNMRKVTKGNVTIKIWDIGGQPRFRSMWERYCRGVNAIVYMIDAADREKIEASRNELHNLLDKPQLQGIPVLVLGNKRDLPNALDEKQLIEKMNLSAIQDREICCYSISCKEKDNIDITLQWLIQHSKSRRS Predict reactive species\nFull Name: ADP-ribosylation factor-like 8B\nCalculated Molecular Weight: 186 aa, 22 kDa\nObserved Molecular Weight: 22 kDa\nGenBank Accession Number: BC013131\nGene Symbol: ARL8B\nGene ID (NCBI): 55207\nRRID: AB_2918647\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q9NVJ2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888100036777,"sku":"67891-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-67891-1-ig","provider":"Iright","version":"1.0","type":"link"}