{"product_id":"proteintech-67905-1-ig","title":"Proteintech, 67905-1-Ig, METTL7A Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe METTL7A (67905-1-Ig) by Proteintech is a Monoclonal antibody targeting METTL7A in WB, IHC, ELISA applications with reactivity to human, mouse, rat, rabbit samples\n67905-1-Ig targets METTL7A in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat, rabbit samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: rat liver tissue, LNCaP cells,  mouse lung tissue,  HepG2 cells,  K-562 cells,  mouse liver tissue,  rabbit liver tissue\nPositive IHC detected in: human thyroid cancer tissue, human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nmethyltransferase like 7A (METTL7A) is a 244 amino acid protein which belongs to the methyltransferase super family. Methyltransferase can transfer a methyl group from a donor to an acceptor. Methylation may be linked to cancer development as methylation of tumor suppressor genes promotes tumorgenesis and metastasis.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat, rabbit\nCited Reactivity: human\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag29986 Product name: Recombinant human METTL7A protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-244 aa of BC008180 Sequence: MELTIFILRLAIYILTFPLYLLNFLGLWSWICKKWFPYFLVRFTVIYNEQMASKKRELFSNLQEFAGPSGKLSLLEVGCGTGANFKFYPPGCRVTCIDPNPNFEKFLIKSIAENRHLQFERFVVAAGENMHQVADGSVDVVVCTLVLCSVKNQERILREVCRVLRPGGAFYFMEHVAAECSTWNYFWQQVLDPAWHLLFDGCNLTRESWKALERASFSKLKLQHIQAPLSWELVRPHIYGYAVK Predict reactive species\nFull Name: methyltransferase like 7A\nCalculated Molecular Weight: 28 kDa\nObserved Molecular Weight: 28 kDa\nGenBank Accession Number: BC008180\nGene Symbol: METTL7A\nGene ID (NCBI): 25840\nRRID: AB_2918661\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q9H8H3\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888067498153,"sku":"67905-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-67905-1-ig","provider":"Iright","version":"1.0","type":"link"}