{"product_id":"proteintech-67944-1-ig","title":"Proteintech, 67944-1-Ig, FcRn Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe FcRn (67944-1-Ig) by Proteintech is a Monoclonal antibody targeting FcRn in WB, IHC, ELISA applications with reactivity to Human samples\n67944-1-Ig targets FcRn in WB, IHC, ELISA applications and shows reactivity with Human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, THP-1 cells\nPositive IHC detected in: human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunohistochemistry (IHC): IHC : 1:5000-1:20000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe neonatal Fc receptor for IgG (FcRn) is a membrane-associated receptor which acts as a key determinant of IgG homeostasis. FcRn is similar in structure to major histocompatibility class I molecules. It is a heterodimer composed of a alpha chain associated with β2-microglobulin. FcRn transfers IgG from the mother to the fetus across the placenta and the proximal small intestine. In addition, throughout life, FcRn protects IgG from degradation and thus regulates the serum half-life of IgG (PMID: 17703228).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag31173 Product name: Recombinant human FCGRT protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 24-297 aa of BC008734 Sequence: AESHLSLLYHLTAVSSPAPGTPAFWVSGWLGPQQYLSYNSLRGEAEPCGAWVWENQVSWYWEKETTDLRIKEKLFLEAFKALGGKGPYTLQGLLGCELGPDNTSVPTAKFALNGEEFMNFDLKQGTWGGDWPEALAISQRWQQQDKAANKELTFLLFSCPHRLREHLERGRGNLEWKEPPSMRLKARPSSPGFSVLTCSAFSFYPPELQLRFLRNGLAAGTGQGDFGPNSDGSFHASSSLTVKSGDEHHYCCIVQHAGLAQPLRVELESPAKSS Predict reactive species\nFull Name: Fc fragment of IgG, receptor, transporter, alpha\nCalculated Molecular Weight: 40 kDa\nObserved Molecular Weight: 35-40 kDa\nGenBank Accession Number: BC008734\nGene Symbol: FcRn\nGene ID (NCBI): 2217\nRRID: AB_2918696\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: P55899\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888276721833,"sku":"67944-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-67944-1-ig","provider":"Iright","version":"1.0","type":"link"}