{"product_id":"proteintech-67950-1-ig","title":"Proteintech, 67950-1-Ig, SERPINB9 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe SERPINB9 (67950-1-Ig) by Proteintech is a Monoclonal antibody targeting SERPINB9 in WB, IHC, IF\/ICC, ELISA applications with reactivity to Human, Mouse, Rat samples\n67950-1-Ig targets SERPINB9 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with Human, Mouse, Rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: K-562 cells, human placenta tissue,  Daudi cells,  Raji cells,  Ramos cells\nPositive IHC detected in: mouse lung tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: C6 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:400-1:1600\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSERPINB9, also named as PI-9, belongs to the serpin family. SERPINB9 is an intracellular inhibitor of granzyme B (grB) that protects cytotoxic lymphocytes from grB-mediated death. It has a nucleo-cytoplasmic distribution and is produced in CD8+ T cells and natural killer cells (PMID: 28024184). Also, SERPINB9 is expressed by vascular SMCs and endothelial cells to avoid GZB-induced apoptosis (PMID: 28743062). The molecular weight of SERPINB9 is 42 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, Mouse, Rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag6719 Product name: Recombinant human SERPINB9 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-376 aa of BC002538 Sequence: METLSNASGTFAIRLLKILCQDNPSHNVFCSPVSISSALAMVLLGAKGNTATQMAQALSLNTEEDIHRAFQSLLTEVNKAGTQYLLRTANRLFGEKTCQFLSTFKESCLQFYHAELKELSFIRAAEESRKHINTWVSKKTEGKIEELLPGSSIDAETRLVLVNAIYFKGKWNEPFDETYTREMPFKINQEEQRPVQMMYQEATFKLAHVGEVRAQLLELPYARKELSLLVLLPDDGVELSTVEKSLTFEKLTAWTKPDCMKSTEVEVLLPKFKLQEDYDMESVLRHLGIVDAFQQGKADLSAMSAERDLCLSKFVHKSFVEVNEEGTEAAAASSCFVVAECCMESGPRFCADHPFLFFIRHNRANSILFCGRFSSP Predict reactive species\nFull Name: serpin peptidase inhibitor, clade B (ovalbumin), member 9\nCalculated Molecular Weight: 42 kDa\nObserved Molecular Weight: 38 kDa\nGenBank Accession Number: BC002538\nGene Symbol: SERPINB9\nGene ID (NCBI): 5272\nRRID: AB_2918702\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: P50453\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888049508521,"sku":"67950-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-67950-1-ig","provider":"Iright","version":"1.0","type":"link"}