{"product_id":"proteintech-67953-1-ig","title":"Proteintech, 67953-1-Ig, RAB14 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe RAB14 (67953-1-Ig) by Proteintech is a Monoclonal antibody targeting RAB14 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat, pig samples\n67953-1-Ig targets RAB14 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat, pig samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: LNCaP cells, pig brain tissue,  HCT 116 cells,  K-562 cells,  HSC-T6 cells,  NIH\/3T3 cells,  HeLa cells,  HEK-293 cells,  Jurkat cells,  rabbit brain tissue,  rat brain tissue,  mouse brain tissue\nPositive IHC detected in: mouse ovary tissue, human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:400-1:1600\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRAB14, the final member of the Rab11 subfamily, participates in the regulation of cell secretion, ensuring the timely release of necessary substances outside the cell. RAB14 is ubiquitously expressed and localizes to the Golgi\/TGN and at early endosomes (PMID: 16962593, 22595670). RAB14 contains 215 amino acids, with a molecular weight of approximately 24.6 kDa\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat, pig\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag8167 Product name: Recombinant human RAB14 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-215 aa of BC006081 Sequence: MATAPYNYSYIFKYIIIGDMGVGKSCLLHQFTEKKFMADCPHTIGVEFGTRIIEVSGQKIKLQIWDTAGQERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDARNLTNPNTVIILIGNKADLEAQRDVTYEEAKQFAEENGLLFLEASAKTGENVEDAFLEAAKKIYQNIQDGSLDLNAAESGVQHKPSAPQGGRLTSEPQPQREGCGC Predict reactive species\nFull Name: RAB14, member RAS oncogene family\nCalculated Molecular Weight: 215 aa, 24 kDa\nObserved Molecular Weight: 24 kDa\nGenBank Accession Number: BC006081\nGene Symbol: RAB14\nGene ID (NCBI): 51552\nRRID: AB_2918705\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: P61106\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888316305577,"sku":"67953-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-67953-1-ig","provider":"Iright","version":"1.0","type":"link"}