{"product_id":"proteintech-67971-1-ig","title":"Proteintech, 67971-1-Ig, HAT1 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe HAT1 (67971-1-Ig) by Proteintech is a Monoclonal antibody targeting HAT1 in WB, IHC, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples\n67971-1-Ig targets HAT1 in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: LNCaP cells, HEK-293 cells,  HeLa cells,  HepG2 cells,  Jurkat cells,  K-562 cells,  HSC-T6 cells,  NIH\/3T3 cells,  4T1 cells\nPositive IHC detected in: rat testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive FC (Intra) detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.4 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag1952 Product name: Recombinant human HAT1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 241-419 aa of BC018682 Sequence: MLILTPFQGQGHGAQLLETVHRYYTEFPTVLDITAEDPSKSYVKLRDFVLVKLCQDLPCFSREKLMQGFNEDMAIEAQQKFKINKQHARRVYEILRLLVTDMSDAEQYRSYRLDIKRRLISPYKKKQRDLAKMRKCLRPEELTNQMNQIEISMQHEQLEESFQELVEDYRRVIERLAQE Predict reactive species\nFull Name: histone acetyltransferase 1\nCalculated Molecular Weight: 419 aa, 50 kDa\nObserved Molecular Weight: 45-46 kDa\nGenBank Accession Number: BC018682\nGene Symbol: HAT1\nGene ID (NCBI): 8520\nRRID: AB_2918721\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: O14929\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888064155817,"sku":"67971-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-67971-1-ig","provider":"Iright","version":"1.0","type":"link"}