{"product_id":"proteintech-67974-1-ig","title":"Proteintech, 67974-1-Ig, LIMK1 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe LIMK1 (67974-1-Ig) by Proteintech is a Monoclonal antibody targeting LIMK1 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat, pig, rabbit samples\n67974-1-Ig targets LIMK1 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, MCF-7 cells,  SH-SY5Y cells,  pig brain tissue,  A431 cells,  HEK-293 cells,  rabbit brain tissue,  rat brain tissue,  mouse brain tissue\nPositive IHC detected in: mouse stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunohistochemistry (IHC): IHC : 1:1000-1:4000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nLIMK1,also named LIMK, belongs to the protein kinase superfamily and TKL Ser\/Thr protein kinase family. LIMK1 is a protein kinase which regulates actin filament dynamics. Phosphorylates and inactivates the actin binding\/depolymerizing factor cofilin, thereby stabilizing the actin cytoskeleton. Isoform 3 has a dominant negative effect on actin cytoskeletal changes. LIMK1 may be involved in brain development. The antibody has no cross-reaction with LIMK2.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat, pig, rabbit\nCited Reactivity: human, mouse\nHost \/ Isotype: Mouse \/ IgG2a\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag28862 Product name: Recombinant human LIMK1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 67-222 aa of BC152982 Sequence: DGQLFCKKDYWARYGESCHGCSEQITKGLVMVAGELKYHPECFICLTCGTFIGDGDTYTLVEHSKLYCGHCYYQTVVTPVIEQILPDSPGSHLPHTVTLVSIPASSHGKRGLSVSIDPPHGPPGCGTEHSHTVRVQGVDPGCMSPDVKNSIHVGDR Predict reactive species\nFull Name: LIM domain kinase 1\nCalculated Molecular Weight: 647 aa, 73 kDa\nObserved Molecular Weight: 65 kDa\nGenBank Accession Number: BC152982\nGene Symbol: LIMK1\nGene ID (NCBI): 3984\nRRID: AB_3085042\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P53667\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888044232873,"sku":"67974-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-67974-1-ig","provider":"Iright","version":"1.0","type":"link"}