{"product_id":"proteintech-67979-1-ig","title":"Proteintech, 67979-1-Ig, SMARCB1 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe SMARCB1 (67979-1-Ig) by Proteintech is a Monoclonal antibody targeting SMARCB1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n67979-1-Ig targets SMARCB1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: NCCIT cells, HepG2 cells,  LNCaP cells,  HeLa cells,  HEK-293 cells,  Jurkat cells,  K-562 cells,  HSC-T6 cells,  NIH\/3T3 cells\nPositive IHC detected in: mouse stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSMARCB1 is part of a complex that relieves repressive chromatin structures, allowing the transcriptional machinery to access its targets more effectively. The encoded nuclear protein may also bind to and enhance the DNA joining activity of HIV-1 integrase. This gene has been found to be a tumor suppressor and mutations in it have been associated with malignant rhabdoid tumors. Two transcript variants encoding different isoforms have been found for this gene.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag28911 Product name: Recombinant human SMARCB1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-164 aa of NM_003073 Sequence: MMMMALSKTFGQKPVKFQLEDDGEFYMIGSEVGNYLRMFRGSLYKRYPSLWRRLATVEERKKIVASSHGKKTKPNTKDHGYTTLATSVTLLKASEVEEILDGNDEKYKAVSISTEPPTYLREQKAKRNSQWVPTLPNSSHHLDAVPCSTTINRNRMGRDKKRTF Predict reactive species\nFull Name: SWI\/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily b, member 1\nCalculated Molecular Weight: 44 kDa\nObserved Molecular Weight: 40-45 kDa\nGenBank Accession Number: NM_003073\nGene Symbol: SMARCB1\nGene ID (NCBI): 6598\nRRID: AB_2918728\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q12824\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888325021865,"sku":"67979-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-67979-1-ig","provider":"Iright","version":"1.0","type":"link"}