{"product_id":"proteintech-68021-1-ig","title":"Proteintech, 68021-1-Ig, CRMP1 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe CRMP1 (68021-1-Ig) by Proteintech is a Monoclonal antibody targeting CRMP1 in WB, IHC, ELISA applications with reactivity to Mouse, Rat, Rabbit, Pig, Chicken, Human samples\n68021-1-Ig targets CRMP1 in WB, IHC, ELISA applications and shows reactivity with Mouse, Rat, Rabbit, Pig, Chicken, Human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse cerebellum tissue, pig brain tissue,  rabbit brain tissue,  rat brain tissue,  mouse brain tissue,  chicken brain tissue,  pig cerebellum tissue,  rabbit cerebellum tissue,  rat cerebellum tissue\nPositive IHC detected in: mouse brain tissue, human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:5000-1:20000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCRMP1 (Collapsin response mediator protein 1) is also named as DPYSL1, ULIP3, DRP-1 and belongs to the collapsin response mediator protein family, which are a family of ﬁve cytoplasmic proteins predominantly expressed in the developing nervous system. CRMP1, the predicted 62 kDa protein and its 74 kDa isoform corresponding to its N-terminal splice variant already described for embryonic, neonatal, and adult brain of the rat are evidenced in the cortex of adult mouse (PMID:15834957). This protein is involved in invasion, and aggressiveness of prolactin pituitary tumors.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Mouse, Rat, Rabbit, Pig, Chicken, Human\nCited Reactivity: human, mouse\nHost \/ Isotype: Mouse \/ IgG2a\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag30090 Product name: Recombinant human CRMP1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 291-537 aa of BC000252 Sequence: WSKNWAKAAAFVTSPPLSPDPTTPDYLTSLLACGDLQVTGSGHCPYSTAQKAVGKDNFTLIPEGVNGIEERMTVVWDKAVATGKMDENQFVAVTSTNAAKIFNLYPRKGRIAVGSDADVVIWDPDKLKTITAKSHKSAVEYNIFEGMECHGSPLVVISQGKIVFEDGNINVNKGMGRFIPRKAFPEHLYQRVKIRNKVFGLQGVSRGMYDGPVYEVPATPKYATPAPSAKSSPSKHQPPPIRNLHQS Predict reactive species\nFull Name: collapsin response mediator protein 1\nCalculated Molecular Weight: 62 kDa\nObserved Molecular Weight: 62 kDa\nGenBank Accession Number: BC000252\nGene Symbol: CRMP1\nGene ID (NCBI): 1400\nRRID: AB_2918766\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q14194\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888059863209,"sku":"68021-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-68021-1-ig","provider":"Iright","version":"1.0","type":"link"}