{"product_id":"proteintech-68024-1-ig","title":"Proteintech, 68024-1-Ig, SFXN1 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe SFXN1 (68024-1-Ig) by Proteintech is a Monoclonal antibody targeting SFXN1 in WB, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n68024-1-Ig targets SFXN1 in WB, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: PC-3 cells, MCF-7 cells,  LNCaP cells,  HepG2 cells,  HeLa cells,  Jurkat cells,  MOLT-4 cells,  Rat brain tissue,  Mouse brain tissue\nPositive IF\/ICC detected in: MCF-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSFXN1, the founding member of the SLC56 family, was identified by positional cloning of the mutation in the flexed-tail mouse model with sideroblastic anemia. SFXN1 was recently identified as a mitochondrial serine transporter essential for one-carbon (1C) metabolism, a process in which folate species are generated and used in biosynthetic pathways required for cell proliferation. In HEK293 cells, SFXN1 is the most abundant isoform among the SFXNs.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag2985 Product name: Recombinant human SFXN1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-236 aa of BC020517 Sequence: MILIGRMSAQVPMNMTITGCMMTFYRTTPAVLFWQWINQSFNAVVNYTNRSGDAPLTVNELGTAYVSATTGAVATALGLNALTKHVSPLIGRFVPFAAVAAANCINIPLMRQRELKVGIPVTDENGNRLGESANAAKQAITQVVVSRILMAAPGMAIPPFIMNTLEKKAFLKRFPWMSAPIQVGLVGFCLVFATPLCCALFPQKSSMSVTSLEAELQAKIQESHPELRRVYFNKGL Predict reactive species\nFull Name: sideroflexin 1\nCalculated Molecular Weight: 35.6 kDa\nObserved Molecular Weight: 32 kDa\nGenBank Accession Number: BC020517\nGene Symbol: SFXN1\nGene ID (NCBI): 94081\nRRID: AB_2918768\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q9H9B4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888323055785,"sku":"68024-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-68024-1-ig","provider":"Iright","version":"1.0","type":"link"}