{"product_id":"proteintech-68049-1-ig","title":"Proteintech, 68049-1-Ig, AIFM2\/ FSP1 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe AIFM2\/ FSP1 (68049-1-Ig) by Proteintech is a Monoclonal antibody targeting AIFM2\/ FSP1 in WB, IHC, IF\/ICC, FC (Intra), IP, ELISA applications with reactivity to human, mouse samples\n68049-1-Ig targets AIFM2\/ FSP1 in WB, IHC, IF\/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: LoVo cells, A549 cells,  HEK-293 cells,  HepG2 cells,  K-562 cells,  MCF-7 cells,  NCI-H1299 cells,  L02 cells,  RKO cells\nPositive IP detected in: K-562 cells\nPositive IHC detected in: mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: H9C2 cells\nPositive FC (Intra) detected in: K-562 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:400-1:1600\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.50 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe human AIFM2 protein (also known as FSP1 or AMID) is an apoptosis associated flavoprotein with a 6-hydroxy FAD cofactor. AIFM2 is a NAD(P)H-binding oxidoreductase with some sequence similarities to A1FM1 (formerly known as AIF, Apoptosis Inducing Factor), a mitochondrion-associated enzyme which relocates to the cell nucleus during apoptosis and is considered to be a key player in the progression of cell death.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag30516 Product name: Recombinant human AIFM2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-373 aa of BC023601 Sequence: MGSQVSVESGALHVVIVGGGFGGIAAASQLQALNVPFMLVDMKDSFHHNVAALRASVETGFAKKTFISYSVTFKDNFRQGLVVGIDLKNQMVLLQGGEALPFSHLILATGSTGPFPGKFNEVSSQQAAIQAYEDMVRQVQRSRFIVVVGGGSAGVEMAAEIKTEYPEKEVTLIHSQVALADKELLPSVRQEVKEILLRKGVQLLLSERVSNLEELPLNEYREYIKVQTDKGTEVATNLVILCTGIKINSSAYRKAFESRLASSGALRVNEHLQVEGHSNVYAIGDCADVRTPKMAYLAGLHANIAVANIVNSVKQRPLQAYKPGALTFLLSMGRNDGVGQISGFYVGRLMVRLTKSRDLFVSTSWKTMRQSPP Predict reactive species\nFull Name: apoptosis-inducing factor, mitochondrion-associated, 2\nCalculated Molecular Weight: 41 kDa\nObserved Molecular Weight: 41 kDa\nGenBank Accession Number: BC023601\nGene Symbol: AIFM2\/ FSP1\nGene ID (NCBI): 84883\nRRID: AB_2918791\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q9BRQ8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887999766697,"sku":"68049-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-68049-1-ig","provider":"Iright","version":"1.0","type":"link"}