{"product_id":"proteintech-68069-1-ig","title":"Proteintech, 68069-1-Ig, ARF1 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe ARF1 (68069-1-Ig) by Proteintech is a Monoclonal antibody targeting ARF1 in WB, IF\/ICC, ELISA applications with reactivity to human, mouse, rat, pig, rabbit samples\n68069-1-Ig targets ARF1 in WB, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A431 cells, LNCaP cells,  HeLa cells,  HEK-293 cells,  HepG2 cells,  pig brain tissue,  rabbit brain tissue,  rat brain tissue,  mouse brain tissue\nPositive IF\/ICC detected in: MCF-7 cells, HeLa cells,  A431 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nADP-ribosylation factors (ARFs) are members of the ARF family of GTP-binding proteins of the Ras superfamily. ARFs bind and regulate GTP\/GDP cycle by alternating between the active GTP-bound and inactive GDP-bound conformations. ARF family proteins are essential and ubiquitous in eukaryotes. Six highly conserved members of the family have been identified in mammalian cells. They function in vesicular traffic and actin remodelling and other bioprocesses in cells. The ARF1 protein is localized to the Golgi apparatus and has a central role in intra-Golgi transport. It mainly functions in coat recruitment.(PMID: 7759471, PMID: 16042562).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat, pig, rabbit\nCited Reactivity: human, mouse\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag28021 Product name: Recombinant human ARF1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-181 aa of BC009247 Sequence: MGNIFANLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLSNQLRNQK Predict reactive species\nFull Name: ADP-ribosylation factor 1\nCalculated Molecular Weight: 21 kDa\nObserved Molecular Weight: 18-21 kDa\nGenBank Accession Number: BC009247\nGene Symbol: ARF1\nGene ID (NCBI): 375\nRRID: AB_2918810\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: P84077\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888036696233,"sku":"68069-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-68069-1-ig","provider":"Iright","version":"1.0","type":"link"}