{"product_id":"proteintech-68070-1-ig","title":"Proteintech, 68070-1-Ig, PTPRF Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe PTPRF (68070-1-Ig) by Proteintech is a Monoclonal antibody targeting PTPRF in WB, ELISA applications with reactivity to Human, mouse, rat samples\n68070-1-Ig targets PTPRF in WB, ELISA applications and shows reactivity with Human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HSC-T6 cells,  4T1 cells,  HEK293 cells,  A549 cells,  LNCaP cells,  MCF-7 cells,  U2OS cells,  Jurkat cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, mouse, rat\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag25441 Product name: Recombinant human PTPRF protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1080-1150 aa of BC048768 Sequence: HLVSIRTAPDLLPHKPLPASAYIEDGRFDLSMPHVQDPSLVRWFYIVVVPIDRVGGSMLTPRWSTPEELEL Predict reactive species\nFull Name: protein tyrosine phosphatase, receptor type, F\nCalculated Molecular Weight: 1898 aa, 212 kDa\nObserved Molecular Weight: 150 kDa, 213 kDa\nGenBank Accession Number: BC048768\nGene Symbol: PTPRF\nGene ID (NCBI): 5792\nRRID: AB_2918811\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: P10586\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888315879593,"sku":"68070-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-68070-1-ig","provider":"Iright","version":"1.0","type":"link"}