{"product_id":"proteintech-68090-1-ig","title":"Proteintech, 68090-1-Ig, FBXW11 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe FBXW11 (68090-1-Ig) by Proteintech is a Monoclonal antibody targeting FBXW11 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n68090-1-Ig targets FBXW11 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, LNCaP cells,  HeLa cells,  HEK-293 cells,  HepG2 cells,  Jurkat cells,  HSC-T6 cells,  NIH\/3T3 cells\nPositive IHC detected in: human colon cancer tissue, human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFBXW11 (also known as HOS or β-TrCP2) is a member of F-box family proteins and plays critical role in regulating the ubiquitination of phosphorylated substrates. Abnormal expression of several FBXW11 is involved in the modulation of various biological events, such as cell cycle, differentiation, migration, inflammation, and apoptosis, through targeting multiple different substrates. For instance, FBXW11 could bind to the phosphorylated IκB and β-catenin, promoting their degradation via the ubiquitin-proteasome system. In addition, FBXW11 expression is markedly increased in mouse skin tumors and promotes tumor growth by activating the NF-κB signaling (PMID: 33640602). FBXW11 has 3 isoforms with the molecular mass of 58-62 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag3761 Product name: Recombinant human FBXW11 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 216-529 aa of BC026213 Sequence: NLQRIQCRSENSKGVYCLQYDDEKIISGLRDNSIKIWDKTSLECLKVLTGHTGSVLCLQYDERVIVTGSSDSTVRVWDVNTGEVLNTLIHHNEAVLHLRFSNGLMVTCSKDRSIAVWDMASATDITLRRVLVGHRAAVNVVDFDDKYIVSASGDRTIKVWSTSTCEFVRTLNGHKRGIACLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWDLQAALDPRAPASTLCLRTLVEHSGRVFRLQFDEFQIISSSHDDTILIWDFLNVPPSAQNETRSPSRTYTYISR Predict reactive species\nFull Name: F-box and WD repeat domain containing 11\nCalculated Molecular Weight: 542 aa, 61 kDa\nObserved Molecular Weight: 58-62 kDa\nGenBank Accession Number: BC026213\nGene Symbol: FBXW11\nGene ID (NCBI): 23291\nRRID: AB_2918827\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q9UKB1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888276590761,"sku":"68090-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-68090-1-ig","provider":"Iright","version":"1.0","type":"link"}