{"product_id":"proteintech-68109-1-ig","title":"Proteintech, 68109-1-Ig, SMG6 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe SMG6 (68109-1-Ig) by Proteintech is a Monoclonal antibody targeting SMG6 in WB, ELISA applications with reactivity to Human, mouse samples\n68109-1-Ig targets SMG6 in WB, ELISA applications and shows reactivity with Human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: LNCaP cells, RAW 264.7 cells,  MCF-7 cells,  HeLa cells,  HEK-293 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSMG6, also known as C17orf31, EST1A, and hEST1A, is a component of the telomerase ribonucleoprotein (RNP) complex that is essential for the replication of chromosome termini (PMID: 19179534). It promotes in vitro the ability of TERT to elongate telomeres (PMID: 12676087, 12699629). SMG6 also plays a role in the nonsense-mediated mRNA decay (NMD) pathway, providing the endonuclease activity near the premature translation termination codon that is needed to initiate NMD (PMID: 19060897, 20930030). Alternate splicing results in multiple transcript variants (PMID: 12699629, 14636577).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, mouse\nHost \/ Isotype: Mouse \/ IgG2a\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag30182 Product name: Recombinant human SMG6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1282-1419 aa of NM_017575 Sequence: ELDGLAKGQETDHRAGGYARVVQEKARKSIEFLEQRFESRDSCLRALTSRGNELESIAFRSEDITGQLGNNDDLILSCCLHYCKDKAKDFMPASKEEPIRLLREVVLLTDDRNLRVKALTRNVPVRDIPAFLTWAQVG Predict reactive species\nFull Name: Smg-6 homolog, nonsense mediated mRNA decay factor (C. elegans)\nCalculated Molecular Weight: 160 kDa\nObserved Molecular Weight: 160 kDa\nGenBank Accession Number: NM_017575\nGene Symbol: SMG6\nGene ID (NCBI): 23293\nRRID: AB_2923638\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q86US8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888325152937,"sku":"68109-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-68109-1-ig","provider":"Iright","version":"1.0","type":"link"}