{"product_id":"proteintech-68112-1-ig","title":"Proteintech, 68112-1-Ig, CEP89, CCDC123 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe CEP89, CCDC123 (68112-1-Ig) by Proteintech is a Monoclonal antibody targeting CEP89, CCDC123 in WB, IF-P, ELISA applications with reactivity to human, mouse samples\n68112-1-Ig targets CEP89, CCDC123 in WB, IF-P, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, A549 cells,  Neuro-2a cells,  A431 cells,  SH-5Y5Y cells,  U-251 cells,  SH-SY5Y cells\nPositive IF-P detected in: mouse eye tissue, hTERT-RPE1 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunofluorescence (IF)-P: IF-P : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCCDC123 (as known as CEP123), also named as CEP89, encodes for a protein required for ciliogenesis. It plays a role in mitochondrial metabolism by modulating complex IV activity. It has been shown that CEP123 is localized to the distal appendages of the mother centriolecep and the localization of CEP123 is cell cycle-dependent with its levels decreasing during mitosis. CEP123 depletion can cause defects in ciliary vesicle formationcep and prevent the formation of a ciliary vesicle at the distal end of the mother centriole. It is possible that CEP123 is involved in regulating the recruitment of membranes to the centrosome through its interaction with CEP290 (PMID:23575228, 23789104, 23348840).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag28339 Product name: Recombinant human CCDC123 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 248-343 aa of BC136328 Sequence: MDLNNMNQSLTLELNTMKQAMKELQLKLKGMEKEKRKLKEAEKASSQEVAAPELLYLRKQAQELVDENDGLKMTVHRLNVELSRYQTKFRHLSKEE Predict reactive species\nFull Name: coiled-coil domain containing 123\nCalculated Molecular Weight: 783 aa, 90 kDa\nObserved Molecular Weight: 90 kDa\nGenBank Accession Number: BC136328\nGene Symbol: CEP89\nGene ID (NCBI): 84902\nRRID: AB_2923641\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q96ST8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888107966633,"sku":"68112-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-68112-1-ig","provider":"Iright","version":"1.0","type":"link"}