{"product_id":"proteintech-68115-1-ig","title":"Proteintech, 68115-1-Ig, PACSIN1 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe PACSIN1 (68115-1-Ig) by Proteintech is a Monoclonal antibody targeting PACSIN1 in WB, IHC, IF\/ICC, IF-P, FC (Intra), ELISA applications with reactivity to human, mouse, rat, pig, rabbit, chicken samples\n68115-1-Ig targets PACSIN1 in WB, IHC, IF\/ICC, IF-P, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit, chicken samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: pig brain tissue, rabbit brain tissue,  rat brain tissue,  mouse brain tissue,  chicken brain tissue\nPositive IHC detected in: mouse cerebellum tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse brain tissue\nPositive IF\/ICC detected in: SH-SY5Y cells\nPositive FC (Intra) detected in: SH-SY5Y cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:2000-1:8000\nImmunofluorescence (IF)-P: IF-P : 1:200-1:800\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:400-1:1600\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPACSIN1 (also known as syndapin-1) is a member of the protein kinase C and casein kinase substrate in neurons (PACSIN) family. In mammals, the PACSIN family is comprised of three members, PACSIN1, PACSIN2, and PACSIN3 (PMID: 34990060). PACSIN1 is expressed mainly in neurons, whereas PACSIN2 is ubiquitously expressed in all tissues, and PACSIN3 is expressed mainly in skeletal muscle and the heart (PMID: 23668323). All of these three members contain an N-terminal F-BAR domain and a C-terminal SH3 domain. PACSIN1 plays a role in endocytosis and endosomal recycling. Meanwhile, it has a role in actin remodeling and microtubule nucleation and also plays a particular role in membrane shaping and reconstruction (PMID: 23035120; 34422904). PACSIN1 is involved in neuromorphogenesis and the regulation of the nervous system, and the inappropriate expression of PACSIN1 has been associated with some neurological diseases, including schizophrenia, Alzheimer's disease, and Huntington's disease (PMID: 34990060).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat, pig, rabbit, chicken\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag4102 Product name: Recombinant human PACSIN1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 243-389 aa of BC040228 Sequence: VFLKEVLLDIKRHLNLAENSSYIHVYRELEQAIRGADAQEDLRWFRSTSGPGMPMNWPQFEEWNPDLPHTTTKKEKQPKKAEGVALTNATGAVESTSQAGDRGSVSSYDRGQPYATEWSDDESGNPFGGSETNGGANPFEDDSKGVR Predict reactive species\nFull Name: protein kinase C and casein kinase substrate in neurons 1\nCalculated Molecular Weight: 444 aa, 51 kDa\nObserved Molecular Weight: 48-51 kDa\nGenBank Accession Number: BC040228\nGene Symbol: PACSIN1\nGene ID (NCBI): 29993\nRRID: AB_2923644\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q9BY11\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888308211881,"sku":"68115-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-68115-1-ig","provider":"Iright","version":"1.0","type":"link"}