{"product_id":"proteintech-68126-1-ig","title":"Proteintech, 68126-1-Ig, RBP5 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe RBP5 (68126-1-Ig) by Proteintech is a Monoclonal antibody targeting RBP5 in WB, IF\/ICC, ELISA applications with reactivity to Human, pig samples\n68126-1-Ig targets RBP5 in WB, IF\/ICC, ELISA applications and shows reactivity with Human, pig samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: pig kidney tissue, pig liver tissue,  pig liver tisse\nPositive IF\/ICC detected in: HepG2 cells, A431 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:400-1:1600\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRBP5 (CRBP III) belongs to the fatty-acid binding protein (FABP) family. Human liver and kidney contain the highest levels of CRBP III mRNA, and CRBP III is as a major human intracellular carrier of retinol (PMID:11274389). RBP5 iron response are reversible by genetic complementation. And increased RBP5 expression occurs by a post-transcriptional feedback mechanism whereby RBP5 interacts with its own, and with PAP2 mRNAs. RBP5 is the most significant of the proteins upregulated by iron starvation (PMID:34161395). RBP5 has an estimated molecular mass (15.9 kDa) typical of this protein superfamily (PMID:11274389).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, pig\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag24562 Product name: Recombinant human RBP5 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-135 aa of BC029355 Sequence: MPPNLTGYYRFVSQKNMEDYLQALNISLAVRKIALLLKPDKEIEHQGNHMTVRTLSTFRNYTVQFDVGVEFEEDLRSVDGRKCQTIVTWEEEHLVCVQKGEVPNRGWRHWLEGEMLYLELTARDAVCEQVFRKVR Predict reactive species\nFull Name: retinol binding protein 5, cellular\nCalculated Molecular Weight: 135 aa, 16 kDa\nObserved Molecular Weight: 16-18 kDa\nGenBank Accession Number: BC029355\nGene Symbol: RBP5\nGene ID (NCBI): 83758\nRRID: AB_2935257\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: P82980\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888318337193,"sku":"68126-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-68126-1-ig","provider":"Iright","version":"1.0","type":"link"}