{"product_id":"proteintech-68137-1-ig","title":"Proteintech, 68137-1-Ig, TSPO\/PBR Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe TSPO\/PBR (68137-1-Ig) by Proteintech is a Monoclonal antibody targeting TSPO\/PBR in WB, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n68137-1-Ig targets TSPO\/PBR in WB, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: K-562 cells, LNCaP cells,  Jurkat cells,  HeLa cells,  HSC-T6 cells,  NIH\/3T3 cells,  4T1 cells\nPositive IF\/ICC detected in: NIH\/3T3 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:16000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:400-1:1600\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTSPO, also named Peripheral-type benzodiazepine receptor (PBR), encodes the translocator protein, belonging to tryptophan-rich sensory protein family. The protein is mainly localized in the outer mitochondrial membrane and expressed in steroid-synthesizing tissues (PMID:32881658, PMID:1326278). TSPO is involved in the translocation of cholesterol from the outer to inner mitochondrial membrane (PMID:21119734). In response to injury, TSPO has a upregulated expression in the peripheral nervous system (PMID:32423330, PMID:23251719). TSPO is also as a biomarker in a non-invasive procedure including detecting the inflammation in the heart and atherosclerotic plaques (PMID:24402571).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Mouse \/ IgM\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag7475 Product name: Recombinant human TSPO protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-169 aa of BC001110 Sequence: MAPPWVPAMGFTLAPSLGCFVGSRFVHGEGLRWYAGLQKPSWHPPHWVLGPVWGTLYSAMGYGSYLVWKELGGFTEKAVVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLLLVSGAAAATTVAWYQVSPLAARLLYPYLAWLAFATTLNYCVWRDNHGWHGGRRLPE Predict reactive species\nFull Name: translocator protein (18kDa)\nCalculated Molecular Weight: 18 kDa\nObserved Molecular Weight: 18 kDa\nGenBank Accession Number: BC001110\nGene Symbol: TSPO\nGene ID (NCBI): 706\nRRID: AB_2923664\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Caprylic acid\/ammonium sulfate precipitation\nUNIPROT ID: P30536\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888034566313,"sku":"68137-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-68137-1-ig","provider":"Iright","version":"1.0","type":"link"}