{"product_id":"proteintech-68163-1-ig","title":"Proteintech, 68163-1-Ig, PPP3CA Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe PPP3CA (68163-1-Ig) by Proteintech is a Monoclonal antibody targeting PPP3CA in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat, pig, rabbit samples\n68163-1-Ig targets PPP3CA in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: SH-SY5Y cells, rabbit skeletal muscle tissue,  pig brain tissue,  rabbit brain tissue,  rat brain tissue,  mouse brain tissue,  rat skeletal muscle\nPositive IP detected in: rat brain tissue\nPositive IHC detected in: human thyroid cancer tissue, mouse skeletal muscle tissue,  rat skeletal muscle tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPPP3CA, also called calcineurin Aα, is the only serine\/threonine protein phosphatase under the control of Ca2+\/calmodulin, and plays a critical role in the coupling of Ca2+ signals to cellular responses. Ca2+ signaling plays a central role in hypertrophic growth of cardiac and skeletal muscle in response to mechanical load and a variety of signals. Therefore, PPP3CA plays an important role in muscle differentiation, especially in muscle fiber type conversion. It is also involved in osteoclast regulation, regulating bone formation through an effect on osteoblast differentiation.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat, pig, rabbit\nHost \/ Isotype: Mouse \/ IgG2b\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag32642 Product name: Recombinant human PPP3CA protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 3-302 aa of BC025714 Sequence: EPKAIDPKLSTTDRVVKAVPFPPSHRLTAKEVFDNDGKPRVDILKAHLMKEGRLEESVALRIITEGASILRQEKNLLDIDAPVTVCGDIHGQFFDLMKLFEVGGSPANTRYLFLGDYVDRGYFSIECVLYLWALKILYPKTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMDAFDCLPLAALMNQQFLCVHGGLSPEINTLDDIRKLDRFKEPPAYGPMCDILWSDPLEDFGNEKTQEHFTHNTVRGCSYFYSYPAVCEFLQHNNLLSILRAHEAQDAGYRMYRKSQTTGFPSL Predict reactive species\nFull Name: protein phosphatase 3 (formerly 2B), catalytic subunit, alpha isoform\nCalculated Molecular Weight: 59 kDa\nObserved Molecular Weight: 59 kDa\nGenBank Accession Number: BC025714\nGene Symbol: PPP3CA\nGene ID (NCBI): 5530\nRRID: AB_2923682\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q08209\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888313421993,"sku":"68163-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-68163-1-ig","provider":"Iright","version":"1.0","type":"link"}