{"product_id":"proteintech-68172-1-ig","title":"Proteintech, 68172-1-Ig, TMEM175 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe TMEM175 (68172-1-Ig) by Proteintech is a Monoclonal antibody targeting TMEM175 in WB, IP, ELISA applications with reactivity to human, mouse, rat, pig, rabbit samples\n68172-1-Ig targets TMEM175 in WB, IP, ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: LNCaP cells, pig liver tissue,  rabbit liver tissue,  HepG2 cells,  mouse brain tissue,  rat liver tissue,  HeLa cells,  HEK-293 cells,  Jurkat cells\nPositive IP detected in: mouse brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTMEM175 has two repeats of 6-transmembrane-spanning segments and has no GYG K+ channel sequence signature-containing, pore-forming P loop. Lysosomes lacking TMEM175 exhibit no K+conductance, have a markedly depolarized ΔΨ and little sensitivity to changes in [K+], and have compromised luminal pH stability and abnormal fusion with autophagosomes during autophagy. TMEM175 comprises a K+ channel that underlies the molecular mechanism of lysosomal K+ permeability.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat, pig, rabbit\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag13890 Product name: Recombinant human TMEM175 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 222-313 aa of BC005158 Sequence: YVSKVTGWCRDRLLGHREPSAHPVEVFSFDLHEPLSKERVEAFSDGVYAIVATLLILDICEDNVPDPKDVKERFSGSLVAALSATGPRFLAY Predict reactive species\nFull Name: transmembrane protein 175\nCalculated Molecular Weight: 504 aa, 56 kDa\nObserved Molecular Weight: 55-60 kDa\nGenBank Accession Number: BC005158\nGene Symbol: TMEM175\nGene ID (NCBI): 84286\nRRID: AB_2923687\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q9BSA9\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887979155625,"sku":"68172-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-68172-1-ig","provider":"Iright","version":"1.0","type":"link"}