{"product_id":"proteintech-68179-1-ig","title":"Proteintech, 68179-1-Ig, ENOPH1 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe ENOPH1 (68179-1-Ig) by Proteintech is a Monoclonal antibody targeting ENOPH1 in WB, FC (Intra), ELISA applications with reactivity to human, mouse, rat, pig, rabbit samples\n68179-1-Ig targets ENOPH1 in WB, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: LNCaP cells, HeLa cells,  HepG2 cells,  Jurkat cells,  pig brain tissue,  rabbit brain tissue,  rat brain tissue,  mouse brain tissue\nPositive FC (Intra) detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nENOPH1, also named as MASA and MSTP145, belongs to the HAD-like hydrolase superfamily and MasA\/MtnC family. ENOPH1 is a newly identified enzyme involved in L-methionine biosynthesis, which is associated with anxiety and depression. Studies have shown that ENOPH1 plays a crucial role in promoting the proliferation and migration of glioma cells (PMID: 32654229). ENOPH1 has 2 isoforms with the molecular mass of 13 and 29 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat, pig, rabbit\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag12553 Product name: Recombinant human ENOPH1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-261 aa of BC065815 Sequence: MVVLSVPAEVTVILLDIEGTTTPIAFVKDILFPYIEENVKEYLQTHWEEEECQQDVSLLRKQAEEDAHLDGAVPIPAASGNGVDDLQQMIQAVVDNVCWQMSLDRKTTALKQLQGHMWRAAFTAGRMKAEFFADVVPAVRKWREAGMKVYIYSSGSVEAQKLLFGHSTEGDILELVDGHFDTKIGHKVESESYRKIADSIGCSTNNILFLTDVTREASAAEEADVHVAVVVRPGNAGLTDDEKTYYSLITSFSELYLPSST Predict reactive species\nFull Name: enolase-phosphatase 1\nCalculated Molecular Weight: 261 aa, 29 kDa\nObserved Molecular Weight: 29-35 kDa\nGenBank Accession Number: BC065815\nGene Symbol: ENOPH1\nGene ID (NCBI): 58478\nRRID: AB_2935270\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q9UHY7\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888274788521,"sku":"68179-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-68179-1-ig","provider":"Iright","version":"1.0","type":"link"}