{"product_id":"proteintech-68191-1-ig","title":"Proteintech, 68191-1-Ig, GNAQ Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe GNAQ (68191-1-Ig) by Proteintech is a Monoclonal antibody targeting GNAQ in WB, ELISA applications with reactivity to human, mouse, rat, pig, rabbit samples\n68191-1-Ig targets GNAQ in WB, ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells, HeLa cells,  rat brain tissue,  pig cerebellum tissue,  rat cerebellum tissue,  MCF-7 cells,  pig brain tissue,  rabbit brain tissue,  mouse brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGNAQ is a proto-oncogene closely related to the α subunit of guanine nucleotide-binding proteins (G proteins) that serve as key intermediates between membrane-bound G-protein-coupled receptors (GPCRs) and GPCR signalling nodes. Aberrant expression and activity of G proteins and GPCRs are frequently associated with tumorigenesis. Recent studies show that oncogenic activating mutations in GNAQ are present in 80% of the melanomas. The calculated molecular weight of GNAQ is 42 kDa. This antibody can detect a band of 38-40 kDa in SDS-PAGE. (PMID: 33993733)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat, pig, rabbit\nHost \/ Isotype: Mouse \/ IgG2b\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag26178 Product name: Recombinant human GNAQ protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 84-205 aa of BC057777 Sequence: FTAMQAMIRAMDTLKIPYKYEHNKAHAQLVREVDVEKVSAFENPYVDAIKSLWNDPGIQECYDRRREYQLSDSTKYYLNDLDRVADPAYLPTQQDVLRVRVPTTGIIEYPFDLQSVIFRMVD Predict reactive species\nFull Name: guanine nucleotide binding protein (G protein), q polypeptide\nCalculated Molecular Weight: 42 kDa\nObserved Molecular Weight: 38-40 kDa\nGenBank Accession Number: BC057777\nGene Symbol: GNAQ\nGene ID (NCBI): 2776\nRRID: AB_2935280\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P50148\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888280817833,"sku":"68191-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-68191-1-ig","provider":"Iright","version":"1.0","type":"link"}