{"product_id":"proteintech-68206-1-ig","title":"Proteintech, 68206-1-Ig, SIRP beta 1\/CD172b Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe SIRP beta 1\/CD172b (68206-1-Ig) by Proteintech is a Monoclonal antibody targeting SIRP beta 1\/CD172b in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat, pig, rabbit samples\n68206-1-Ig targets SIRP beta 1\/CD172b in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: rat cerebellum tissue, rabbit cerebellum tissue,  pig cerebellum tissue,  mouse brain tissue,  rat brain tissue,  rabbit brain tissue,  pig brain tissue,  U-937 cells\nPositive IHC detected in: human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: OS-RC-2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:1000-1:4000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSIRP Beta 1 is a member of the signal-regulatory-protein (SIRP) family and also belongs to the immunoglobulin superfamily. SIRP family members are cell surface signaling receptors differentially expressed in leukocytes and the central nervous system. SIRP Beta 1 interacts with TYROBP\/DAP12, a protein-bearing immunoreceptor tyrosine-based activation motif. SIRP Beta 1 also participates in the recruitment of tyrosine kinase SYK.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat, pig, rabbit\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag28615 Product name: Recombinant human SIRPB1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-181 aa of BC025286 Sequence: MPVPASWPHLPSPFLLMTLLLGRLTGVAGEDELQVIQPEKSVSVAAGESATLRCAMTSLIPVGPIMWFRGAGAGRELIYNQKEGHFPRVTTVSELTKRNNLDFSISISNITPADAGTYYCVKFRKGSPDDVEFKSGAGTELSVREPALAPTAPLLVALLLGPKLLLVVGVSAIYICWKQKA Predict reactive species\nFull Name: signal-regulatory protein beta 1\nCalculated Molecular Weight: 43 kDa\nObserved Molecular Weight: 43 kDa\nGenBank Accession Number: BC025286\nGene Symbol: SIRPB1\nGene ID (NCBI): 10326\nRRID: AB_2935294\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: O00241\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888323973289,"sku":"68206-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-68206-1-ig","provider":"Iright","version":"1.0","type":"link"}